Recombinant European hazel Cor a 1 Protein, N-His

Cat# NB-21-32331

Size : 100µg

Marca : Neo Biotech


Recombinant European hazel Cor a 1 Protein, N-His

Product name ARO-P15691-100
Uniprot ID Q08407
Origin species European hazel
Expression system Prokaryotic expression
Raw Antigen Sequence MGVFNYEVETPSVIPAARLFKSYVLDGDKLIPKVAPQAITSVENVEGNGGPGTIKNITFGEGSRYKYVKERVDEVDNTNFTYSYTVIEGDVLGDKLEKVCHELKIVAAPGGGSILKISSKFHAKGDHEINAEEMKGAKEMAEKLLRAVETYLLAHSAEYN
Molecular weight 19.67 kDa
Protein delivered with Tag? N-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Host species Escherichia coli (E.coli)
Fragment Type Met1-Asn160
Aliases /Synonyms Major pollen allergen Cor a 1 isoforms 5, 6, 11 and 16, Allergen Cor a I, Cor a 1
Reference ARO-P15691
Note For research use only.
Molecular Constructor
His Met1–Asn160