Recombinant Mouse Versican core protein(Vcan),partial - E.coli

Cat# CSB-EP720284MO-10ug

Size : 10ug

Marca : Cusabio


CSB-EP720284MO
Abbreviation Recombinant Mouse Vcan protein, partial
MSDS
Image
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP720284MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Vcan.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP720284MO could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Vcan.
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Vcan; Cspg2Versican core protein; Chondroitin sulfate proteoglycan core protein 2; Chondroitin sulfate proteoglycan 2; Large fibroblast proteoglycan; PG-M
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
24-146aa
Target Protein Sequence
AKMETSPPVKGSLSGKVVLPCHFSTLPTLPPNYNTSEFLRIKWSKMEVDKNGKDIKETTVLVAQNGNIKIGQDYKGRVSVPTHPDDVGDASLTMVKLRASDAAVYRCDVMYGIEDTQDTMSLA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
20.9 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The preparation of this recombinant Mouse Vcan protein was to use gene recombination DNA technology to obtain a recombinant vector connected with a Vcan fragment (24-146aa) that could be translated into the Vcan protein and then transferred it into E.coli cells to express the recombinant Vcan protein molecule. In order to get the target protein with high purity, N-terminal 10xHis tag & C-terminal Myc tag was used in the production. The purity is 85% determined by SDS-PAGE.

VCAN, a large aggregating chondroitin sulfate proteoglycan belonging to the lexicon family, ...

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

 Q&A
Q:

Does the "Recombinant Mouse Versican core protein (Vcan)" has GAG-beta region or GAG-alpha region?

A:

Our instock products neither cover GAG-beta region nor GAG-alpha region. However, we can provide risk-based customized services for the recombinant mouse Versican core protein (Vcan) that covers the GAG-alpha region (348-1308aa).$861 is charged for fail expression. Only the protein, not the plasmid, will be provided for successful expression. The fee for suc...

Target Background

Function
May play a role in intercellular signaling and in connecting cells with the extracellular matrix. May take part in the regulation of cell motility, growth and differentiation. Binds hyaluronic acid.
Subcellular Location
Secreted, extracellular space, extracellular matrix. Cell projection, cilium, photoreceptor outer segment. Secreted, extracellular space, extracellular matrix, interphotoreceptor matrix.
Protein Families
Aggrecan/versican proteoglycan family
Tissue Specificity
Expressed in the retina (at protein level). Isoform V2: Only expressed in brain.
Database Links

.section-table {width: 100%;}.text-default {background: rgb(43, 47, 49);color: white;}.section-table {background-color: blue;}.pdts-relatetitle {padding-left: 5px;line-height: 2;}.pdts-detail-con .item {border-bottom: solid 1.5px rgb(58, 62, 65);display: flex;justify-content: space-between;padding: 9px;}.pdts-detail-con .item:last-child {border-bottom: none;}.pdts-detail-con .item .name {width: 25%;align-self: center;font-weight: 600;font-size: 16px;line-height: 1.5;padding: 5px 0;padding-right: 10px;}.pdts-detail-con .item .value {width: 75%;padding: 5px 0;line-height: 1.5;}table {border-collapse: collapse;}table td {padding: 6px!important;}table tr {border-bottom: solid 1.5px rgb(58, 62, 65);}table tr:last-child {border-bottom: none;}

Si può anche essere interessati nei seguenti prodotti:



Cat#
Descrizione
Cond.
Priced
A4050-10mg
 10mg