STAP1 (BRDG1, Signal-transducing Adaptor Protein 1, Stem Cell Adaptor Protein 1, BCR Downstream-signaling Protein 1, Docking Protein BRDG1)
Cat# 133923-100ug
Size : 100ug
Marca : US Biological
133923 STAP1 (BRDG1, Signal-transducing Adaptor Protein 1, Stem Cell Adaptor Protein 1, BCR Downstream-signaling Protein 1, Docking Protein BRDG1)
Clone Type
MonoclonalHost
mouseSource
humanIsotype
IgG1,kGrade
Affinity PurifiedApplications
E WBCrossreactivity
HuAccession #
NM_012108, NP_036240Shipping Temp
Blue IceStorage Temp
-20°CSTAP1 functions as a docking protein acting downstream of Tec tyrosine kinase in B cell antigen receptor signaling. The protein is directly phosphorylated by Tec in vitro where it participates in a postive feedback loop, increasing Tec activity.
Applications:
Suitable for use in ELISA and Western Blot. Other applications not tested.
Recommended Dilutions:
Optimal dilutions to be determined by the researcher.
Amino Acid Sequence:
EATEMLQKNPSLGNMILRPGSDSRNYSITIRQEIDIPRIKHYKVMSVGQNYTIELEKPVTLPNLFSVIDYFVKETRGNLRPFICSTDENTGQEPSMEGRSEKLKKNPH
Storage and Stability:
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

