Orb624045-20ug | Animal hyperglycemic hormones protein Clinisciences

Animal hyperglycemic hormones protein

SKU: orb624045

This Animal hyperglycemic hormones protein spans the amino acid sequence from region 67-138aa. Purity: Greater than 85% as determined by SDS-PAGE.

Epigenetics, Neuroscience

−

Application Notes	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

−

Source	E.coli
Biological Origin	Carcinus maenas (Common shore crab) (Green crab)
Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region	67-138aa
Protein Length	Partial
MW	16.0 kDa
Purity	Greater than 85% as determined by SDS-PAGE.
Protein Sequence	QIYDTSCKGVYDRALFNDLEHVCDDCYNLYRTSYVASACRSNCYSNLVFRQCMDDLLMMDEFDQYARKVQMV

−

Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Form/Appearance	Liquid or Lyophilized powder
Buffer/Preservatives	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Expiration Date	6 months from date of receipt.
Disclaimer	For research use only

−

Crustacean hyperglycemic hormones [Cleaved into, CHH precursor-related peptide, CPRP), Crustacean hyperglycemic hormone, CHH)]

UniProt

−

No UniProt data available

Protein Handling and Storage Guide

Protein Handling Guide