Anti-Bovine Bos d 11/CSN2 Polyclonal Antibody

Cat# NB-21-40198

Size : 100µg

Marca : Neo Biotech


Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US (" height="17" viewBox="0 0 17 17" fill="none" xmlns="http://www.w3.org/2000/svg"> Close

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Close
Clonality:
Polyclonal Antibody
Host species:
Rabbit
Isotype:
IgG

Specifications Anti-Bovine Bos d 11/CSN2 Polyclonal Antibody

Product name ARO-A19846-100
Uniprot ID P02666
Raw Antigen Sequence RELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQDKIHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSKVKEAMAPKHKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSLSQSKVLPVPQKAVPYPQRDMPIQAFLLYQEPVLGPVRGPFPIIV
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Bos d 11, Anti-CSN2
Isotype IgG
Clonality Polyclonal Antibody
Protein Name Bos d 11
Product name ARO-A19846-1MG
Uniprot ID P02666
Raw Antigen Sequence RELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQDKIHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSKVKEAMAPKHKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSLSQSKVLPVPQKAVPYPQRDMPIQAFLLYQEPVLGPVRGPFPIIV
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Bos d 11, Anti-CSN2
Isotype IgG
Clonality Polyclonal Antibody
Protein Name Bos d 11
Product name ARO-A19846-50
Uniprot ID P02666
Raw Antigen Sequence RELEELNVPGEIVESLSSSEESITRINKKIEKFQSEEQQQTEDELQDKIHPFAQTQSLVYPFPGPIPNSLPQNIPPLTQTPVVVPPFLQPEVMGVSKVKEAMAPKHKEMPFPKYPVEPFTESQSLTLTDVENLHLPLPLLQSWMHQPHQPLPPTVMFPPQSVLSLSQSKVLPVPQKAVPYPQRDMPIQAFLLYQEPVLGPVRGPFPIIV
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-Bos d 11, Anti-CSN2
Isotype IgG
Clonality Polyclonal Antibody
Protein Name Bos d 11

Documents

QC & Validation

Anti-Bovine Bos d 11/CSN2 Polyclonal Antibody binds to Recombinant Bovine Bos d 11/CSN2 Protein, N-His in WB Assay

Anti-Bovine Bos d 11/CSN2 Polyclonal Antibody binds to Recombinant Bovine Bos d 11/CSN2 Protein, N-His in WB Assay

Recombinant Bovine Bos d 11/CSN2 Protein, N-His(cat. No.ARO-P16698) can bind Anti-Bovine Bos d 11/CSN2 Polyclonal Antibody in Western Blot Assay as detected on gel analysis.

Reviews

There are no reviews yet.

Be the first to review “Anti-Bovine Bos d 11/CSN2 Polyclonal Antibody” Cancel reply

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call