BCAS2 Antibody - middle region
Cat# ARP40613_P050-25UL
Size : 25ul
Marca : Aviva Systems Biology
BCAS2 Antibody - middle region (ARP40613_P050)
| Datasheets/Manuals | Printable datasheet for anti-BCAS2 (ARP40613_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human BCAS2 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: SKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-BCAS2 (ARP40613_P050) antibody is Catalog # AAP40613 (Previous Catalog # AAPP22776) |
| Reference | Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007) |
|---|---|
| Gene Symbol | BCAS2 |
| Gene Full Name | Breast carcinoma amplified sequence 2 |
| Alias Symbols | DAM1, SPF27, Snt309 |
| NCBI Gene Id | 10286 |
| Protein Name | Pre-mRNA-splicing factor SPF27 |
| Description of Target | BCAS2 belongs to the SPF27 family. It is involved in mRNA splicing. The protein might play an important role in breast cancer development by increasing the estrogen receptor's function. |
| Uniprot ID | O75934 |
| Protein Accession # | NP_005863 |
| Nucleotide Accession # | NM_005872 |
| Protein Size (# AA) | 225 |
| Molecular Weight | 26kDa |
| Protein Interactions | GOLGA2; KRT40; IKZF3; HGS; AIMP2; TCF4; UBC; RPA3; RPA2; RPA1; SUZ12; EED; RNF2; CSNK2A2; TXNRD2; PPARG; PGR; ESR2; ESR1; POT1; PRPF8; SF3B4; SF1; EP300; CDC5L; PRPF19; EIF4A3; MAGOH; VASN; SF3B6; NCSTN; SNRNP200; ACIN1; HNRNPA0; SRSF10; RBM39; EFTUD2; PR |


