Carnitine O-palmitoyltransferase 1, liver isoform(CPT1A)

Cat# NB-21-24362

Size : 50ug

Marca : Neo Biotech


Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US (" height="17" viewBox="0 0 17 17" fill="none" xmlns="http://www.w3.org/2000/svg"> Close

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Close
Host species:
Escherichia coli (E.coli)
Uniprot ID:
P50416
Molecular weight:
38.45 kDa
His Gln406–Thr745

Specifications Carnitine O-palmitoyltransferase 1, liver isoform(CPT1A)

Product name Carnitine O-palmitoyltransferase 1, liver isoform(CPT1A)
Uniprot ID P50416
Uniprot link https://www.uniprot.org/uniprot/P50416
Expression system Prokaryotic expression
Raw Antigen Sequence QSLDAVEKAAFFVTLDETEEGYRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTGSGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLINFHISSKFSCPET
Molecular weight 38.45 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln406-Thr745
Protein Accession P50416
Spec:Entrez GeneID 1374
Spec:NCBI Gene Aliases CPT1; CPT1-L; L-CPT1
Spec:SwissProtID Q8TCU0
NCBI Reference P50416
Aliases /Synonyms CPT1-L,Carnitine O-palmitoyltransferase I, liver isoform,CPT I,CPTI-L,Carnitine palmitoyltransferase 1A,CPT1A,CPT1
Reference PX-P4721
Note For research use only
Molecular Constructor
His Gln406–Thr745
Product name Carnitine O-palmitoyltransferase 1, liver isoform(CPT1A)
Uniprot ID P50416
Uniprot link https://www.uniprot.org/uniprot/P50416
Expression system Prokaryotic expression
Raw Antigen Sequence QSLDAVEKAAFFVTLDETEEGYRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTGSGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLINFHISSKFSCPET
Molecular weight 38.45 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln406-Thr745
Protein Accession P50416
Spec:Entrez GeneID 1374
Spec:NCBI Gene Aliases CPT1; CPT1-L; L-CPT1
Spec:SwissProtID Q8TCU0
NCBI Reference P50416
Aliases /Synonyms CPT1-L,Carnitine O-palmitoyltransferase I, liver isoform,CPT I,CPTI-L,Carnitine palmitoyltransferase 1A,CPT1A,CPT1
Reference PX-P4721
Note For research use only
Molecular Constructor
His Gln406–Thr745
Product name PX-P4721-1MG
Uniprot ID P50416
Uniprot link https://www.uniprot.org/uniprot/P50416
Expression system Prokaryotic expression
Raw Antigen Sequence QSLDAVEKAAFFVTLDETEEGYRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTGSGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLINFHISSKFSCPET
Molecular weight 38.45 kDa
Protein delivered with Tag? N-terminal His Tag
Purity estimated >90%by SDS-PAGE
Buffer PBS pH 7.5, 0.02% SKL
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gln406-Thr745
Protein Accession P50416
Spec:Entrez GeneID 1374
Spec:NCBI Gene Aliases CPT1; CPT1-L; L-CPT1
Spec:SwissProtID Q8TCU0
NCBI Reference P50416
Aliases /Synonyms CPT1-L,Carnitine O-palmitoyltransferase I, liver isoform,CPT I,CPTI-L,Carnitine palmitoyltransferase 1A,CPT1A,CPT1
Reference PX-P4721
Note For research use only
Molecular Constructor
His Gln406–Thr745

Documents

3D Representation

Carnitine O-palmitoyltransferase 1, liver isoform(CPT1A)

Reviews

There are no reviews yet.

Be the first to review “Carnitine O-palmitoyltransferase 1, liver isoform(CPT1A)” Cancel reply

Related products

  • Carnitine O-palmitoyltransferase 1, liver isoform(CPT1A)

    PX-P4721

    Carnitine O-palmitoyltransferase 1, liver isoform(CPT1A)