NB-21-24434 | CD81 Recombinant Protein Clinisciences

Host species:: Escherichia coli (E.coli)
Origin species:: Homo sapiens (Human)
Uniprot ID:: P60033
Molecular weight:: 10.59kDa

His Phe113~Lys201

Datasheet

Specifications CD81 Recombinant Protein

Product name	PX-P4091-100
Uniprot ID	P60033
Uniprot link	http://www.uniprot.org/uniprot/P60033
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Raw Antigen Sequence	FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK
Molecular weight	10.59kDa
Protein delivered with Tag?	N-terminal His Tag
Purity estimated	>90% by SDS-PAGE
Buffer	PBS pH7.5
Delivery condition	Dry Ice
Storage condition	Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Phe113~Lys201
Aliases /Synonyms	TAPA1, TSPAN28
Reference	PX-P4091
Note	For research use only
Molecular Constructor	His Phe113~Lys201

Product name	PX-P4091-1MG
Uniprot ID	P60033
Uniprot link	http://www.uniprot.org/uniprot/P60033
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Raw Antigen Sequence	FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK
Molecular weight	10.59kDa
Protein delivered with Tag?	N-terminal His Tag
Purity estimated	>90% by SDS-PAGE
Buffer	PBS pH7.5
Delivery condition	Dry Ice
Storage condition	Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Phe113~Lys201
Aliases /Synonyms	TAPA1, TSPAN28
Reference	PX-P4091
Note	For research use only
Molecular Constructor	His Phe113~Lys201

Product name	PX-P4091-50
Uniprot ID	P60033
Uniprot link	http://www.uniprot.org/uniprot/P60033
Origin species	Homo sapiens (Human)
Expression system	Prokaryotic expression
Raw Antigen Sequence	FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK
Molecular weight	10.59kDa
Protein delivered with Tag?	N-terminal His Tag
Purity estimated	>90% by SDS-PAGE
Buffer	PBS pH7.5
Delivery condition	Dry Ice
Storage condition	Store at - 20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage.
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Phe113~Lys201
Aliases /Synonyms	TAPA1, TSPAN28
Reference	PX-P4091
Note	For research use only
Molecular Constructor	His Phe113~Lys201

Description

General Information about CD81 Recombinant Protein

CD81, also known as TAPA-1, belongs to the transmembrane superfamily 4, also known as the tetraspanin family. Members of this family mediate transduction events that play a role in the regulation of cell development, activation, growth and movement. CD81 is a widely expressed cell surface protein that participates in various amazing biological reactions. It involves the adhesion, morphology, activation, proliferation and differentiation of B cells, T cells and other cells. On B cells, CD81 is part of a complex with CD21, CD19 and Leul3. The combination of ag-specific recognition and CD21-mediated complementary recognition of the complex lowers the threshold for activation of the B cell B cell receptor.

Documents

Datasheet

3D Representation

Reviews

There are no reviews yet.

Be the first to review “CD81 Recombinant Protein” Cancel reply

CD81 Recombinant Protein

Cat# NB-21-24434

Marca : Neo Biotech