ClfA Protein, S. aureus (strain COL), Recombinant (E. coli, His)
Cat# NB-64-52199-10ug
Size : 10ug
Marca : Neo Biotech
Remove All
ClfA Protein, S. aureus (strain COL), Recombinant (E. coli, His)
(Synonyms: Fibrinogen-binding protein A, Fibrinogen receptor A, Clumping factor A, clfA) Copy Product InfoSynonyms: Fibrinogen-binding protein A, Fibrinogen receptor A, Clumping factor A, clfA
Catalog No. TMPH-03530 Copy Product Info
Cell surface-associated protein implicated in virulence. Promotes bacterial attachment exclusively to the gamma-chain of human fibrinogen. Induces formation of bacterial clumps. ClfA Protein, S. aureus (strain COL), Recombinant (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 40.0 kDa and the accession number is Q5HHM8.
For research use only—not for human use. No sales to individuals. Use as intended only.
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Cell surface-associated protein implicated in virulence. Promotes bacterial attachment exclusively to the gamma-chain of human fibrinogen. Induces formation of bacterial clumps. ClfA Protein, S. aureus (strain COL), Recombinant (E. coli, His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 40.0 kDa and the accession number is Q5HHM8. |
| Species | Staphylococcus aureus |
| Expression System | E. coli |
| Tag | N-6xHis |
| Accession Number | Q5HHM8 |
| Amino Acid | GTDITNQLTNVTVGIDSGTTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAGDQVLANGVIDSDGNVIYTFTDYVNTKDDVKATLTMPAYIDPENVKKTGNVTLATGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPENFEDVTNSVNITFPNPNQYKVEFNTPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYNSNIIWRSMSWDNEVAFNNGSGSGDGIDKPVVPEQPDEPGEIEPIPE |
| Construction | 229-559 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | Fibrinogen-binding protein A, Fibrinogen receptor A, Clumping factor A, clfA |
| Research Background | Cell surface-associated protein implicated in virulence. Promotes bacterial attachment exclusively to the gamma-chain of human fibrinogen. Induces formation of bacterial clumps. |
| Molecular Weight | 40.0 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Keywords
Clumping factor-A
Related Tags: ClfA Protein, S. aureus (strain COL), Recombinant (E. coli, His) chemical structure | ClfA Protein, S. aureus (strain COL), Recombinant (E. coli, His) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote

