KLF4 (Kruppel-like Factor 4 (gut), EZF, GKLF) (MaxLight 490)
Cat# 247963-ML490-100ul
Size : 100ul
Marca : US Biological
247963-ML490 KLF4 (Kruppel-like Factor 4 (gut), EZF, GKLF) (MaxLight 490)
Clone Type
MonoclonalHost
mouseIsotype
IgG1,kGrade
PurifiedApplications
FLISA IF WBAccession #
AAH29923Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeMaxLight™490 is a new Blue-Green photostable dye conjugate comparable to DyLight™488, Alexa Fluor™488 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (491nm); Emission (515nm); Extinction Coefficient 73,000.
Mouse monoclonal antibody raised against a partial recombinant KLF4.
Applications:
Suitable for use in Immunofluorescence, Western Blot. Other applications not tested.
Recommended Dilution:
Optimal dilutions to be determined by the researcher.
AA Sequence:
VLKASLSAPGSEYGSPSVISVSKGSPDGSHPVVVAPYNGGPPRTCPKIKQEAVSSCTHLGAGPPLSNGHRPAAHDFPLGRQLPSRTTPTLGLEEVLSSRD
Storage and Stability:
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.

