lptD Recombinant Protein
Cat# OPCA03163-1MG
Size : 1mg
Marca : Aviva Systems Biology
LPTD Recombinant Protein (Salmonella typhi) (OPCA03163)
| Datasheets/Manuals | Printable datasheet for LPTD Recombinant Protein (Salmonella typhi) (OPCA03163) |
|---|
| Predicted Species Reactivity | Salmonella enterica|Salmonella typhi |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Host | Salmonella typhi |
| Additional Information | Relevance: Together with LptE, is involved in the assembly of lipopolysaccharide (LPS) at the surface of the outer membrane. |
| Reconstitution and Storage | -20°C or -80°C |
| Formulation | 20 mM Tris-HCl based buffer, pH 8.0 |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Peptide Sequence | VDIMQGNSRLQADEVQLHQKQAEGQPEPVRTVDALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDYQMVGRQGRGKADLMKQRGENRYTILENGS |
| Protein Sequence | VDIMQGNSRLQADEVQLHQKQAEGQPEPVRTVDALGNVHYDDNQVILKGPKGWANLNTKDTNVWEGDYQMVGRQGRGKADLMKQRGENRYTILENGS |
| Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source | E.coli |
| Protein Range | 73-169 aa |
| Tag | N-terminal 6xHis-SUMO-tagged |
| Reference | Complete genome sequence of a multiple drug resistant Salmonella enterica serovar Typhi CT18.Parkhill J., Dougan G., James K.D., Thomson N.R., Pickard D., Wain J., Churcher C.M., Mungall K.L., Bentley S.D., Holden M.T.G., Sebaihia M., Baker S., Basham D., Brooks K., Chillingworth T., Connerton P., Cronin A., Davis P. Barrell B.G.Nature 413:848-852(2001) |
|---|---|
| Gene Symbol | STY0108 |
| Gene Full Name | organic solvent tolerance protein |
| Alias Symbols | imp, STY0108. |
| NCBI Gene Id | 1246607 |
| Protein Name | LPS-assembly protein LptD |
| Description of Target | Together with LptE, is involved in the assembly of lipopolysaccharide (LPS) at the surface of the outer membrane. |
| Uniprot ID | Q8Z9J6 |
| Protein Accession # | NP_454705.1 |
| Nucleotide Accession # | NC_003198.1 |
| Protein Size (# AA) | Partial |
| Molecular Weight | 26.9 kDa |