PTX17851
Size : 100ug
| Product name | Peptidoglycan hydrolase |
|---|---|
| Uniprot ID | A0A411CWC0 |
| Origin species | Thermus phage TSP4 |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | MRLPTKTSRFGYVHGQRNHEGIPHPGYDLNNGPTPTSDLGQPVYAPEDGVVVYARTGSGTWGGLVVVLGKSGFAHRLGHVRNIRVKEGQEVKEGQQVAEIGEFVKGLPHLHYDMVEPKVIHTISILIKAPYVRWDFWHVNFPKLFEHMYVDPARFHPELAKLLGGKGSHHHHHH |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >90%by SDS-PAGE |
| Buffer | PBS, pH7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Bacillus subtilis |
| Fragment Type | Met1-Lys166 |
| Reference | PX-P4658 |
| Note | For research use only |
| Molecular Constructor | Met1–Lys166 His |
| Product name | Peptidoglycan hydrolase |
|---|---|
| Uniprot ID | A0A411CWC0 |
| Origin species | Thermus phage TSP4 |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | MRLPTKTSRFGYVHGQRNHEGIPHPGYDLNNGPTPTSDLGQPVYAPEDGVVVYARTGSGTWGGLVVVLGKSGFAHRLGHVRNIRVKEGQEVKEGQQVAEIGEFVKGLPHLHYDMVEPKVIHTISILIKAPYVRWDFWHVNFPKLFEHMYVDPARFHPELAKLLGGKGSHHHHHH |
| Protein delivered with Tag? | C-terminal His Tag |
| Purity estimated | >90%by SDS-PAGE |
| Buffer | PBS, pH7.5 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Bacillus subtilis |
| Fragment Type | Met1-Lys166 |
| Reference | PX-P4658 |
| Note | For research use only |
| Molecular Constructor | Met1–Lys166 His |
PTX17851
There are no reviews yet.