Recombinant Human WNT1 Protein, N-His

Specifications Recombinant Human WNT1 Protein, N-His

Product name	ARO-P11618-100
Uniprot ID	P04628
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	GRWWGIVNVASSTNLLTDSKSLQLVLEPSLQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASR
Molecular weight	27.44 kDa
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Gly32-Arg255
Aliases /Synonyms	WNT1, Proto-oncogene Wnt-1, INT1, Proto-oncogene Int-1 homolog
Reference	ARO-P11618
Note	For research use only.
Molecular Constructor	Gly32–Arg255

Product name	ARO-P11618-1MG
Uniprot ID	P04628
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	GRWWGIVNVASSTNLLTDSKSLQLVLEPSLQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASR
Molecular weight	27.44 kDa
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Gly32-Arg255
Aliases /Synonyms	WNT1, Proto-oncogene Wnt-1, INT1, Proto-oncogene Int-1 homolog
Reference	ARO-P11618
Note	For research use only.
Molecular Constructor	Gly32–Arg255

Product name	ARO-P11618-50
Uniprot ID	P04628
Origin species	Human
Expression system	Prokaryotic expression
Raw Antigen Sequence	GRWWGIVNVASSTNLLTDSKSLQLVLEPSLQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASR
Molecular weight	27.44 kDa
Buffer	Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition	Dry Ice
Delivery lead time in business days	3-5 days if in stock; 3-5 weeks if production needed
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Gly32-Arg255
Aliases /Synonyms	WNT1, Proto-oncogene Wnt-1, INT1, Proto-oncogene Int-1 homolog
Reference	ARO-P11618
Note	For research use only.
Molecular Constructor	Gly32–Arg255

Documents

• Datasheet

3D Representation

Reviews

There are no reviews yet.

Be the first to review “Recombinant Human WNT1 Protein, N-His” Cancel reply