Recombinant JEV Peptide pr Protein, N-GST & C-His

Cat# NB-21-35132

Size : 100µg

Marca : Neo Biotech


Recombinant JEV Peptide pr Protein, N-GST & C-His

Product name ARO-P16864-100
Uniprot ID P0DOK8
Origin species Japanese encephalitis virus (strain M28) (JEV)
Expression system Prokaryotic expression
Raw Antigen Sequence MKLSNFQGKLLMTINNTDIADVIVIPTSKGENRCWVRAIDVGYMCEDTITYECPKLAVGNDPEDVDCWCDNQEVYVQYGRCTRTRHSKRSRR
Molecular weight 38.84 kDa
Protein delivered with Tag? N-Terminal GST & C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Host species Escherichia coli (E.coli)
Fragment Type Met128-Arg219
Aliases /Synonyms Structural polyprotein, Peptide pr
Reference ARO-P16864
Note For research use only.
Molecular Constructor
GST Met128–Arg219 His