Recombinant Mouse CD73/NT5E Protein, N-His

Cat# NB-21-33426

Size : 100µg

Marca : Neo Biotech


Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US (" height="17" viewBox="0 0 17 17" fill="none" xmlns="http://www.w3.org/2000/svg"> Close

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Close
Host species:
Escherichia coli (E.coli)
Origin species:
Mouse
Uniprot ID:
Q61503
Molecular weight:
32.98 kDa
Ala28–Asn308

Specifications Recombinant Mouse CD73/NT5E Protein, N-His

Product name ARO-P10535-100
Uniprot ID Q61503
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence AWELTILHTNDVHSRLEQTSDDSTKCLNASLCVGGVARLFTKVQQIRKEEPNVLFLDAGDQYQGTIWFTVYKGLEVAHFMNILGYDAMALGNHEFDNGVEGLIDPLLRNVKFPILSANIKARGPLAHQISGLFLPSKVLSVGGEVVGIVGYTSKETPFLSNPGTNLVFEDEISALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDIVVGGHSNTFLYTGNPPSKEVPAGKYPFIVTADDGRQVPVVQAYAFGKYLGYLKVEFDDKGNVITSYGN
Molecular weight 32.98 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala28-Asn308
Aliases /Synonyms CD73, 5'-nucleotidase, NT5E, NT5, 5'-NT, Ecto-5'-nucleotidase, NTE
Reference ARO-P10535
Note For research use only.
Molecular Constructor
Ala28–Asn308
Product name ARO-P10535-1MG
Uniprot ID Q61503
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence AWELTILHTNDVHSRLEQTSDDSTKCLNASLCVGGVARLFTKVQQIRKEEPNVLFLDAGDQYQGTIWFTVYKGLEVAHFMNILGYDAMALGNHEFDNGVEGLIDPLLRNVKFPILSANIKARGPLAHQISGLFLPSKVLSVGGEVVGIVGYTSKETPFLSNPGTNLVFEDEISALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDIVVGGHSNTFLYTGNPPSKEVPAGKYPFIVTADDGRQVPVVQAYAFGKYLGYLKVEFDDKGNVITSYGN
Molecular weight 32.98 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala28-Asn308
Aliases /Synonyms CD73, 5'-nucleotidase, NT5E, NT5, 5'-NT, Ecto-5'-nucleotidase, NTE
Reference ARO-P10535
Note For research use only.
Molecular Constructor
Ala28–Asn308
Product name ARO-P10535-50
Uniprot ID Q61503
Origin species Mouse
Expression system Prokaryotic expression
Raw Antigen Sequence AWELTILHTNDVHSRLEQTSDDSTKCLNASLCVGGVARLFTKVQQIRKEEPNVLFLDAGDQYQGTIWFTVYKGLEVAHFMNILGYDAMALGNHEFDNGVEGLIDPLLRNVKFPILSANIKARGPLAHQISGLFLPSKVLSVGGEVVGIVGYTSKETPFLSNPGTNLVFEDEISALQPEVDKLKTLNVNKIIALGHSGFEMDKLIAQKVRGVDIVVGGHSNTFLYTGNPPSKEVPAGKYPFIVTADDGRQVPVVQAYAFGKYLGYLKVEFDDKGNVITSYGN
Molecular weight 32.98 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Ala28-Asn308
Aliases /Synonyms CD73, 5'-nucleotidase, NT5E, NT5, 5'-NT, Ecto-5'-nucleotidase, NTE
Reference ARO-P10535
Note For research use only.
Molecular Constructor
Ala28–Asn308

Documents

3D Representation

Recombinant Mouse CD73/NT5E Protein, N-His

Reviews

There are no reviews yet.

Be the first to review “Recombinant Mouse CD73/NT5E Protein, N-His” Cancel reply

Related products

  • SDS-PAGE for Anti-Mouse CD73/NT5E Antibody (SAA0267)

    ARO-A15663

    Anti-Mouse CD73/NT5E Antibody (SAA0267)