Small-CRP Protein, Chlamydia trachomatis, Recombinant (His & SUMO)
Cat# NB-64-49070-1mg
Size : 1mg
Marca : Neo Biotech
Remove All
Small-CRP Protein, Chlamydia trachomatis, Recombinant (His & SUMO)
(Synonyms: Small-CRP, Small cysteine-rich outer membrane protein OmcA, omp3, omp2A, omcA, 9 kDa cysteine-rich lipoprotein (9kDa-CRP)) Copy Product InfoSynonyms: Small-CRP, Small cysteine-rich outer membrane protein OmcA, omp3, omp2A, omcA, 9 kDa cysteine-rich lipoprotein (9kDa-CRP)
Catalog No. TMPH-00392 Copy Product Info
In elementary bodies (EBs, the infectious stage, which is able to survive outside the host cell) provides the structural integrity of the outer envelope through disulfide cross-links with the large cysteine-rich periplasmic protein and the major outer membrane porin. It has been described in publications as the Sarkosyl-insoluble COMC (Chlamydia outer membrane complex), and serves as the functional equivalent of peptidoglycan. Small-CRP Protein, Chlamydia trachomatis, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 23.4 kDa and the accession number is P0CC05.
For research use only—not for human use. No sales to individuals. Use as intended only.
Product Information
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | In elementary bodies (EBs, the infectious stage, which is able to survive outside the host cell) provides the structural integrity of the outer envelope through disulfide cross-links with the large cysteine-rich periplasmic protein and the major outer membrane porin. It has been described in publications as the Sarkosyl-insoluble COMC (Chlamydia outer membrane complex), and serves as the functional equivalent of peptidoglycan. Small-CRP Protein, Chlamydia trachomatis, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 23.4 kDa and the accession number is P0CC05. |
| Species | Chlamydia trachomatis |
| Expression System | E. coli |
| Tag | N-6xHis-SUMO |
| Accession Number | P0CC05 |
| Amino Acid | CCRIVDCCFEDPCAPIQCSPCESKKKDVDGGCNSCNGYVPACKPCGGDTHQDAKHGPQARGIPVDGKCRQ |
| Construction | 19-88 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | Small-CRP, Small cysteine-rich outer membrane protein OmcA, omp3, omp2A, omcA, 9 kDa cysteine-rich lipoprotein (9kDa-CRP) |
| Research Background | In elementary bodies (EBs, the infectious stage, which is able to survive outside the host cell) provides the structural integrity of the outer envelope through disulfide cross-links with the large cysteine-rich periplasmic protein and the major outer membrane porin. It has been described in publications as the Sarkosyl-insoluble COMC (Chlamydia outer membrane complex), and serves as the functional equivalent of peptidoglycan. |
| Molecular Weight | 23.4 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | It is recommended to store recombinant proteins at -20°C to -80°C for future use. Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Keywords
omp 39kDa-CRP9kDaCRP
Related Tags: Small-CRP Protein, Chlamydia trachomatis, Recombinant (His & SUMO) chemical structure | Small-CRP Protein, Chlamydia trachomatis, Recombinant (His & SUMO) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote

