TRMT5 Antibody - middle region : FITC

Cat# ARP48868_P050-FITC

Size : 100ul

Marca : Aviva Systems Biology

Contatta il distributore locale :


Telefono : +1 850 650 7790

Datasheets/ManualsPrintable datasheet for anti-TRMT5 (ARP48868_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rat, Cow, Dog, Horse, Pig, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human TRMT5
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 77%; Dog: 85%; Horse: 83%; Human: 100%; Pig: 77%; Rabbit: 75%; Rat: 82%
Peptide SequenceSynthetic peptide located within the following region: EMLCITFQIPASVLYKNQTRNPENHEDPPLKRQRTAEAFSDEKTQIVSNT
Concentration0.5 mg/ml
Blocking PeptideFor anti-TRMT5 (ARP48868_P050) antibody is Catalog # AAP48868 (Previous Catalog # AAPP28921)
Sample Type Confirmation

TRMT5 is supported by BioGPS gene expression data to be expressed in MCF7

ReferenceBrule,H., (2004) Biochemistry 43 (28), 9243-9255
Gene SymbolTRMT5
Gene Full NameTRM5 tRNA methyltransferase 5 homolog (S. cerevisiae)
Alias SymbolsTRM5, COXPD26, KIAA1393
NCBI Gene Id57570
Protein NametRNA (guanine(37)-N1)-methyltransferase
Description of TargettRNAs contain as many as 13 or 14 nucleotides that are modified posttranscriptionally by enzymes that are highly specific for particular nucleotides in the tRNA structure. TRMT5 methylates the N1 position of guanosine-37 (G37) in selected tRNAs using S-adenosyl methionine.tRNAs contain as many as 13 or 14 nucleotides that are modified posttranscriptionally by enzymes that are highly specific for particular nucleotides in the tRNA structure. TRMT5 methylates the N1 position of guanosine-37 (G37) in selected tRNAs using S-adenosyl methionine (Brule et al., 2004 [PubMed 15248782]).[supplied by OMIM].
Uniprot IDQ32P41
Protein Accession #NP_065861
Nucleotide Accession #NM_020810
Protein Size (# AA)509
Molecular Weight58kDa
Protein InteractionsUBC;
  1. What is the species homology for "TRMT5 Antibody - middle region (ARP48868_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat, Cow, Dog, Horse, Pig, Rabbit".

  2. How long will it take to receive "TRMT5 Antibody - middle region (ARP48868_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "TRMT5 Antibody - middle region (ARP48868_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "TRMT5 Antibody - middle region (ARP48868_P050)"?

    This target may also be called "TRM5, COXPD26, KIAA1393" in publications.

  5. What is the shipping cost for "TRMT5 Antibody - middle region (ARP48868_P050)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "TRMT5 Antibody - middle region (ARP48868_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "TRMT5 Antibody - middle region (ARP48868_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "58kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "TRMT5 Antibody - middle region (ARP48868_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "TRMT5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "TRMT5"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "TRMT5"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "TRMT5"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "TRMT5"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "TRMT5"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.