TSG101 Antibody - middle region

Cat# ARP37310_T100-25UL

Size : 25ul

Marca : Aviva Systems Biology


TSG101 Antibody - middle region (ARP37310_T100)

Datasheets/ManualsPrintable datasheet for anti-TSG101 (ARP37310_T100) antibody
Product Info
Publications

Efficient inhibition of infectious prions multiplication and release by targeting the exosomal pathway

Authors: Vilette, D., Laulagnier, K., et al.

Journal: Cell Mol Life Sci. 72, 4409-27 (2015)

Tested Species ReactivityMouse
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Mouse
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 86%; Goat: 93%; Guinea Pig: 93%; Horse: 79%; Human: 79%; Mouse: 100%; Rabbit: 79%; Rat: 100%
Peptide SequenceSynthetic peptide located within the following region: RSELLELIQIMIVIFGEEPPVFSRPTVSASYPPYTATGPPNTSYMPGMPS
Concentration1.0 mg/ml
Blocking PeptideFor anti-TSG101 (ARP37310_T100) antibody is Catalog # AAP37310 (Previous Catalog # AAPS05712)
ReferenceStefan,M., (er) BMC Genomics 6, 157 (2005)
Gene SymbolTSG101
Gene Full NameTumor susceptibility gene 101
Alias SymbolsCC2, AI255943
NCBI Gene Id22088
Protein NameTumor susceptibility gene 101 protein
Description of TargetTSG101 has a direct role in the control of growth and differentiation in primary epithelial cells. It is required for normal cell function of embryonic and adult tissues but that this gene is not a tumor suppressor for sporadic forms of breast cancer.
Uniprot IDQ61187
Protein Accession #NP_068684
Nucleotide Accession #NM_021884
Protein Size (# AA)391
Molecular Weight43kDa
Protein InteractionsNr3c2; Ndfip1; SH3KBP1; Ppp1cc; Gjd3; Gjb3; Gjc1; Gja1; Ubc; Mgrn1; Tsg101; Nfe2; Ikbkg; Gmcl1;

Si può anche essere interessati nei seguenti prodotti:



Cat#
Descrizione
Cond.
Priced
4030-05
 1.0mL 
CPA1130-30ul
 30ul 
A18239-50
 50mg