Vascular endothelial growth factor A(VEGFA)

Cat# NB-21-25350

Size : 50ug

Marca : Neo Biotech


Host species:
Mammalian cells
Uniprot ID:
P15692-4
Molecular weight:
20.13kDa
Met1–Arg191 His

Specifications Vascular endothelial growth factor A(VEGFA)

Product name Vascular endothelial Growth Factor proteins A(VEGFA)
Uniprot ID P15692-4
Uniprot link https://www.uniprot.org/uniprot/P15692#P15692-4
Expression system Eukaryotic expression
Raw Antigen Sequence MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Molecular weight 20.13kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Arg191
Protein Accession P15692
Spec:Entrez GeneID 7422
Spec:NCBI Gene Aliases VPF; VEGF; MVCD1
Spec:SwissProtID Q074Z4
NCBI Reference P15692
Aliases /Synonyms VEGF,VPF
Reference PX-P4574
Note For research use only
Molecular Constructor
Met1–Arg191 His
Product name Vascular endothelial Growth Factor proteins A(VEGFA)
Uniprot ID P15692-4
Uniprot link https://www.uniprot.org/uniprot/P15692#P15692-4
Expression system Eukaryotic expression
Raw Antigen Sequence MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Molecular weight 20.13kDa
Protein delivered with Tag? C-terminal His Tag
Purity estimated >90% by SDS-PAGE
Buffer PBS pH 7.5
Delivery condition Dry Ice
Delivery lead time in business days Europe: 5-7 working days
USA & Canada: 7-10 working days
Rest of the world: 5-12 working days
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Mammalian cells
Fragment Type Met1-Arg191
Protein Accession P15692
Spec:Entrez GeneID 7422
Spec:NCBI Gene Aliases VPF; VEGF; MVCD1
Spec:SwissProtID Q074Z4
NCBI Reference P15692
Aliases /Synonyms VEGF,VPF
Reference PX-P4574
Note For research use only
Molecular Constructor
Met1–Arg191 His

Documents

3D Representation

Vascular endothelial growth factor A(VEGFA)

Reviews

There are no reviews yet.

Be the first to review “Vascular endothelial growth factor A(VEGFA)” Cancel reply

Related products

  • SDS-PAGE for Anti-Human CD309;KDR;VEGFR-2 (IMC-1C11) Biosimilar - Anti-CD309;VEGFR-2 mAb - Research Grade

    PX-TA1132

    IMC-1C11 Biosimilar – Anti-VEGFA mAb – Research Grade