MAFB Antibody - N-terminal region

Cat# ARP33682_T100-25UL

Size : 25ul

Marca : Aviva Systems Biology

Contatta il distributore locale :


Telefono : +1 850 650 7790

Rating:
80% of 100
Datasheets/ManualsPrintable datasheet for anti-MAFB (ARP33682_T100) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human MAFB
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 85%; Guinea Pig: 100%; Horse: 77%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Yeast: 82%; Zebrafish: 91%
Peptide SequenceSynthetic peptide located within the following region: MAAELSMGPELPTSPLAMEYVNDFDLLKFDVKKEPLGRAERPGRPCTRLQ
Concentration1.0 mg/ml
Blocking PeptideFor anti-MAFB (ARP33682_T100) antibody is Catalog # AAP33682 (Previous Catalog # AAPS07906)
Enhanced Validation
WB  
SPR  
YCHAROS
ReferenceBakri,Y., (2005) Blood 105 (7), 2707-2716
Gene SymbolMAFB
Gene Full NameV-maf musculoaponeurotic fibrosarcoma oncogene homolog B (avian)
Alias SymbolsKRML, MCTO, DURS3
NCBI Gene Id9935
Protein NameTranscription factor MafB
Description of TargetMAFB is a basic leucine zipper (bZIP) transcription factor that plays an important role in the regulation of lineage-specific hematopoiesis. The nuclear protein represses ETS1-mediated transcription of erythroid-specific genes in myeloid cells.The protein encoded by this gene is a basic leucine zipper (bZIP) transcription factor that plays an important role in the regulation of lineage-specific hematopoiesis. The encoded nuclear protein represses ETS1-mediated transcription of erythroid-specific genes in myeloid cells. This gene contains no introns.
Uniprot IDQ9Y5Q3
Protein Accession #NP_005452
Nucleotide Accession #NM_005461
Protein Size (# AA)323
Molecular Weight36 kDa
Protein InteractionsMAFB; FOSL1; MAF; FOS; BACH1; ATF4; IKBKE; IRF7; IRF3; ZWINT; ZFP64; ZDHHC2; DDB1; JUN; HOXD12;
  1. What is the species homology for "MAFB Antibody - N-terminal region (ARP33682_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Yeast, Zebrafish".

  2. How long will it take to receive "MAFB Antibody - N-terminal region (ARP33682_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MAFB Antibody - N-terminal region (ARP33682_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MAFB Antibody - N-terminal region (ARP33682_T100)"?

    This target may also be called "KRML, MCTO, DURS3" in publications.

  5. What is the shipping cost for "MAFB Antibody - N-terminal region (ARP33682_T100)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "MAFB Antibody - N-terminal region (ARP33682_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MAFB Antibody - N-terminal region (ARP33682_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "36 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MAFB Antibody - N-terminal region (ARP33682_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MAFB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MAFB"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MAFB"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MAFB"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MAFB"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MAFB"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.