AMH antibody - middle region

Referentie ARP54312_P050

Formaat : 100ul

Merk : Aviva Systems Biology

Neem contact op met een lokale distributeur :


Telefoonnummer : +1 850 650 7790

Datasheets/ManualsPrintable datasheet for anti-AMH (ARP54312_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Sheep
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Additional InformationIHC Information: Western analysis of fetal small intestine lysate.
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human AMH
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Sheep: 100%
Peptide SequenceSynthetic peptide located within the following region: SVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQARG
Concentration0.5 mg/ml
Blocking PeptideFor anti-AMH (ARP54312_P050) antibody is Catalog # AAP54312 (Previous Catalog # AAPP31061)
Enhanced Validation
Relative Expression (Western Blot) Avivasheild
ReferenceRohr,J., (2008) Hum. Reprod. 23 (5), 1220-1225
Publications

Bovine gonadotrophs express anti-Müllerian hormone (AMH): comparison of AMH mRNA and protein expression levels between old Holsteins and young and old Japanese Black females. Reprod Fertil Dev. 31, 810-819 (2019) 30554590

Decreased Anti-Müllerian hormone and Anti-Müllerian hormone receptor type 2 in hypothalami of old Japanese Black cows. J Vet Med Sci. 82, 1113-1117 (2020). 32554955

Tezak, B., I. Romero, S. Milton and J. Wyneken. Identifying Sex of Neonate Turtles with Temperature-dependent Sex Determination via Small Blood Samples. Sci Rep. 2020 10: 5012. 32193464

Description
Gene SymbolAMH
Gene Full NameAnti-Mullerian hormone
Alias SymbolsMIF, MIS
NCBI Gene Id268
Protein NameMuellerian-inhibiting factor
Description of TargetAnti-Mullerian hormone is a member of the transforming growth factor-beta gene family which mediates male sexual differentiation. Anti-Mullerian hormone causes the regression of Mullerian ducts which would otherwise differentiate into the uterus and fallopian tubes. Some mutations in the anti-Mullerian hormone result in persistent Mullerian duct syndrome.Anti-Mullerian hormone is a member of the transforming growth factor-beta gene family which mediates male sexual differentiation. Anti-Mullerian hormone causes the regression of Mullerian ducts which would otherwise differentiate into the uterus and fallopian tubes. Some mutations in the anti-Mullerian hormone result in persistent Mullerian duct syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Uniprot IDQ6GTN3
Protein Accession #NP_000470
Nucleotide Accession #NM_000479
Protein Size (# AA)560
Molecular Weight59 kDa
Protein InteractionsZMAT2; ARL8B; ETV5; COPS5; PCSK5; AMHR2; EGFR;
  1. What is the species homology for "AMH Antibody - middle region (ARP54312_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Sheep".

  2. How long will it take to receive "AMH Antibody - middle region (ARP54312_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "AMH Antibody - middle region (ARP54312_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "AMH Antibody - middle region (ARP54312_P050)"?

    This target may also be called "MIF, MIS" in publications.

  5. What is the shipping cost for "AMH Antibody - middle region (ARP54312_P050)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "AMH Antibody - middle region (ARP54312_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "AMH Antibody - middle region (ARP54312_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "59 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "AMH Antibody - middle region (ARP54312_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "AMH"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "AMH"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "AMH"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "AMH"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "AMH"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "AMH"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Misschien heeft u ook interesse in de volgende producten:



Referentie
Beschrijving
Cond.
Price Bef. VAT
OAAB06540
 200ul