CD63 Peptide - C-terminal region

Referentie AAP60760

Formaat : 100ug

Merk : Aviva Systems Biology


 

CD63 Peptide - C-terminal region (AAP60760)

Data Sheet
 
Sku AAP60760
Old sku AAPP48023
Name CD63 Peptide - C-terminal region (AAP60760)
Purchase info To purchase this peptide:
  • Copy peptide sku
  • Click on this link
  • Paste into field "Peptide Sku"
Size 100ug
Gene CD63
Alias symbols LAMP-3, ME491, MLA1, OMA81H, TSPAN30
Gene id 967
Description of target The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. It may function as a blood platelet activation marker. Deficiency of this protein is associated with Hermansky-Pudlak syndrome. Also this gene has been associated with tumor progression. The use of alternate polyadenylation sites has been found for this gene.
Swissprot id P08962
Protein accession num NP_001771
Nucleotide accession num NM_001780
Protein size 238 amino acids
Molecular weight 26kDa
Species reactivity Human
Application WB
Peptide sequence TDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRK
Quality control The peptide is characterized by mass spectroscopy
Key reference N/A
Description This is a synthetic peptide designed for use in combination with anti-CD63 Antibody (ARP60760_P050), made by Aviva Systems Biology. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. There is no guarantee for its use in other applications. Please inquire for more details.
Product format Lyophilized powder
Reconstitution and storage Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20C. Avoid repeat freeze-thaw cycles.
Lead time Domestic: within 24 hours delivery  International: 3-5 business days
Protocol
Tips

See our General FAQ page.

Availability In Stock
 

Misschien heeft u ook interesse in de volgende producten:



Referentie
Beschrijving
Cond.
Price Bef. VAT
4030-05
 1.0mL 
AAP61171
 100ug 
AAP65757
 100ug