CPNE1 Antibody - N-terminal region - Biotin

Referentie ARP40504_T100-Biotin

Formaat : 100ul

Merk : Aviva Systems Biology


CPNE1 Antibody - N-terminal region : Biotin (ARP40504_T100-Biotin)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-CPNE1 (ARP40504_T100-Biotin) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationIHC, WB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CPNE1
Predicted Homology Based on Immunogen SequenceCow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Sheep: 93%; Zebrafish: 79%
Peptide SequenceSynthetic peptide located within the following region: TVQKLRFGIYDIDNKTPELRDDDFLGGAECSLGQIVSSQVLTLPLMLKPG
Concentration0.5 mg/ml
Blocking PeptideFor anti-CPNE1 (ARP40504_T100-Biotin) antibody is Catalog # AAP40504 (Previous Catalog # AAPP22709)
Sample Type Confirmation

CPNE1 is supported by BioGPS gene expression data to be expressed in HepG2

ReferenceTomsig,J.L., Biochem. J. 378 (PT 3), 1089-1094 (2004)
Gene SymbolCPNE1
Gene Full NameCopine I
Alias SymbolsCPN1, COPN1
NCBI Gene Id8904
Protein NameCopine-1
Description of TargetCalcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. CPNE1 is a calcium-dependent protein that also contains two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. However, the protein does not contain a predicted signal sequence or transmembrane domains. This protein has a broad tissue distribution and it may function in membrane trafficking.Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene encodes a calcium-dependent protein that also contains two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. However, the encoded protein does not contain a predicted signal sequence or transmembrane domains. This protein has a broad tissue distribution and it may function in membrane trafficking. This gene and the gene for RNA binding motif protein 12 overlap at map location 20q11.21. Sequence analysis identified multiple alternatively spliced variants in the 5' UTR. All variants encode the same protein.
Uniprot IDQ99829
Protein Accession #NP_003906
Nucleotide Accession #NM_003915
Protein Size (# AA)537
Molecular Weight59kDa
Protein InteractionsUBC; BAG3; BUB3; STK3; FN1; LIG4; TIMM13; TTLL12; ST13; PYGB; ARRB2; SUMO2; UIMC1; HNRNPH1; UBE2O; WTAP; MYCBP; PITPNM2; CCDC22; BCOR; CPNE4; CPNE1; UBE2M; PDCD6; PPP5C; SPTBN1; RDX; MAP2K1; SKIL; ACTB; Cdc42bpb; Etl4; Cenpf; Mycbp2; Alg2; Nono;