CPNE1 Antibody - N-terminal region - Biotin
Referentie ARP40504_T100-Biotin
Formaat : 100ul
Merk : Aviva Systems Biology
CPNE1 Antibody - N-terminal region : Biotin (ARP40504_T100-Biotin)
Click here to learn more about Aviva's By-Request Conjugation Service.
| Datasheets/Manuals | Printable datasheet for anti-CPNE1 (ARP40504_T100-Biotin) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | Biotin |
| Application | IHC, WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CPNE1 |
| Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Sheep: 93%; Zebrafish: 79% |
| Peptide Sequence | Synthetic peptide located within the following region: TVQKLRFGIYDIDNKTPELRDDDFLGGAECSLGQIVSSQVLTLPLMLKPG |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-CPNE1 (ARP40504_T100-Biotin) antibody is Catalog # AAP40504 (Previous Catalog # AAPP22709) |
| Sample Type Confirmation | CPNE1 is supported by BioGPS gene expression data to be expressed in HepG2 |
| Reference | Tomsig,J.L., Biochem. J. 378 (PT 3), 1089-1094 (2004) |
|---|---|
| Gene Symbol | CPNE1 |
| Gene Full Name | Copine I |
| Alias Symbols | CPN1, COPN1 |
| NCBI Gene Id | 8904 |
| Protein Name | Copine-1 |
| Description of Target | Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. CPNE1 is a calcium-dependent protein that also contains two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. However, the protein does not contain a predicted signal sequence or transmembrane domains. This protein has a broad tissue distribution and it may function in membrane trafficking.Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene encodes a calcium-dependent protein that also contains two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. However, the encoded protein does not contain a predicted signal sequence or transmembrane domains. This protein has a broad tissue distribution and it may function in membrane trafficking. This gene and the gene for RNA binding motif protein 12 overlap at map location 20q11.21. Sequence analysis identified multiple alternatively spliced variants in the 5' UTR. All variants encode the same protein. |
| Uniprot ID | Q99829 |
| Protein Accession # | NP_003906 |
| Nucleotide Accession # | NM_003915 |
| Protein Size (# AA) | 537 |
| Molecular Weight | 59kDa |
| Protein Interactions | UBC; BAG3; BUB3; STK3; FN1; LIG4; TIMM13; TTLL12; ST13; PYGB; ARRB2; SUMO2; UIMC1; HNRNPH1; UBE2O; WTAP; MYCBP; PITPNM2; CCDC22; BCOR; CPNE4; CPNE1; UBE2M; PDCD6; PPP5C; SPTBN1; RDX; MAP2K1; SKIL; ACTB; Cdc42bpb; Etl4; Cenpf; Mycbp2; Alg2; Nono; |




