FSH protein - Chinese sturgeon Follicle-stimulating hormone(Follicle) Recombinant Protein
Referentie NB-21-23097
Formaat : 100ug
Formaat : 100ug
| Product name | FSH protein - Chinese sturgeon Follicle-stimulating hormone(Follicle) Recombinant Protein |
|---|---|
| Uniprot ID | B2CKR3 |
| Uniprot link | http://www.uniprot.org/uniprot/B2CKR3 |
| Origin species | Chinese sturgeon |
| Expression system | Eukaryotic expression |
| Raw Antigen Sequence | MASVLFCFVLLCWAAGQCHASCALENITIGIEKDGCGNCVSVNTTSCAGRCLTQADVYKSSISLYTQLVCTFKEISYVTVQLPNCPEHVDPFYTYPVALSCECGQCATDYTDCGTLSLGPSDCFSQEDDDDDKDKTHTCPPCPAPELLGGPSVFLFPPKPKDQLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVLHEALHNHYTQKSLSLSPGK |
| Molecular weight | 39.85 kDa |
| Protein delivered with Tag? | Yes |
| Purity estimated | 90% |
| Buffer | PBS, pH 7.5 |
| Form | Frozen |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | 5-7 |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Host species | Mammalian cells |
| Fragment Type | Full-length |
| NCBI Reference | B2CKR3 |
| Aliases /Synonyms | Follicle Stimulating Hormone, FSH |
| Reference | PX-P3016 |
| Note | For research use only |
| Molecular Constructor | Full-length Yes |