Reagentia en instrumenten voor immunologie, celbiologie en moleculaire biologie.
 
> FUT8 antibody - N-terminal region

FUT8 antibody - N-terminal region

Afdrukken Afdrukken
Log in alstublieft

Referentie ARP60784_P050

Formaat : 100ul

Merk : Aviva Systems Biology

Neem contact op met een lokale distributeur :


Telefoonnummer : +1 850 650 7790

  • Titration: 1.0 ug/ml
    Positive Control: Fetal LiverHuman Fetal liver
  • Target: FUT8
    Positive control (+): Human Stomach Tumor (T-ST)
    Negative control (-): Human Liver Tumor (T-LI)
    Antibody concentration: 3ug/mlHuman Stomach Tumor, Human Liver Tumor
Datasheets/ManualsPrintable datasheet for anti-FUT8 (ARP60784_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 85%
Peptide SequenceSynthetic peptide located within the following region: LVQRRITYLQNPKDCSKAKKLVCNINKGCGYGCQLHHVVYCFMIAYGTQR
Concentration0.5 mg/ml
Blocking PeptideFor anti-FUT8 (ARP60784_P050) antibody is Catalog # AAP60784 (Previous Catalog # AAPP48225)
Gene SymbolFUT8
Gene Full NameFucosyltransferase 8 (alpha (1,6) fucosyltransferase)
Alias SymbolsCDGF, CDGF1
NCBI Gene Id2530
Protein NameAlpha-(1,6)-fucosyltransferase
Description of TargetThis gene encodes an enzyme belonging to the family of fucosyltransferases. The product of this gene catalyzes the transfer of fucose from GDP-fucose to N-linked type complex glycopeptides. This enzyme is distinct from other fucosyltransferases which catalyze alpha1-2, alpha1-3, and alpha1-4 fucose addition. The expression of this gene may contribute to the malignancy of cancer cells and to their invasive and metastatic capabilities. Alternative splicing results in multiple transcript variants.
Uniprot IDQ9BYC5
Protein Accession #NP_004471
Nucleotide Accession #NM_004480
Protein Size (# AA)412
Molecular Weight47kDa
Protein InteractionsUBC; env; ACIN1; SLC25A17; RPL27; DHX15;
Biological pathways
Name# of Products
Protein glycosylation in Golgi1
Biological process
Name# of Products
Cell migration113
Cellular protein metabolic process268
In utero embryonic development199
Integrin-mediated signaling pathway79
L-fucose catabolic process5
N-glycan fucosylation1
N-glycan processing6
Oligosaccharide biosynthetic process14
Post-translational protein modification125
Protein glycosylation in Golgi2
Protein N-linked glycosylation14
Protein N-linked glycosylation via asparagine68
Receptor metabolic process1
Respiratory gaseous exchange25
Transforming growth factor beta receptor signaling pathway95
Cellular components
Name# of Products
Golgi apparatus794
Golgi cisterna membrane49
Golgi membrane308
Integral to membrane2793
Membrane2769
Protein function
Name# of Products
Glycoprotein 6-alpha-L-fucosyltransferase activity1
SH3 domain binding272
Transferase activity, transferring glycosyl groups257

  1. What is the species homology for "FUT8 Antibody - N-terminal region (ARP60784_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish".

  2. How long will it take to receive "FUT8 Antibody - N-terminal region (ARP60784_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "FUT8 Antibody - N-terminal region (ARP60784_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "FUT8 Antibody - N-terminal region (ARP60784_P050)"?

    This target may also be called "CDGF, CDGF1" in publications.

  5. What is the shipping cost for "FUT8 Antibody - N-terminal region (ARP60784_P050)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "FUT8 Antibody - N-terminal region (ARP60784_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "FUT8 Antibody - N-terminal region (ARP60784_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "47kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "FUT8 Antibody - N-terminal region (ARP60784_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "FUT8"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "FUT8"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "FUT8"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "FUT8"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "FUT8"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "FUT8"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.