Human adenovirus C serotype 5 DNA-binding protein (His)
Referentie NB-64-49576-10ug
Formaat : 10ug
Merk : Neo Biotech
Remove All
Human adenovirus C serotype 5 DNA-binding protein (His)
(Synonyms: Early E2A DNA-binding protein, Early 2A protein, DNA-binding protein, DBP) Copy Product InfoSynonyms: Early E2A DNA-binding protein, Early 2A protein, DNA-binding protein, DBP
Catalog No. TMPH-00898 Copy Product Info
Human adenovirus C serotype 5 DNA-binding protein (His) is expressed in Baculovirus insect cells with N-10xHis tag. The predicted molecular weight is 42.3 kDa and the accession number is P03265.
For research use only—not for human use. No sales to individuals. Use as intended only.
Product Information
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Human adenovirus C serotype 5 DNA-binding protein (His) is expressed in Baculovirus insect cells with N-10xHis tag. The predicted molecular weight is 42.3 kDa and the accession number is P03265. |
| Species | HAdV-5 |
| Expression System | Baculovirus Insect Cells |
| Tag | N-10xHis |
| Accession Number | P03265 |
| Amino Acid | SVPIVSAWEKGMEAARALMDKYHVDNDLKANFKLLPDQVEALAAVCKTWLNEEHRGLQLTFTSKKTFVTMMGRFLQAYLQSFAEVTYKHHEPTGCALWLHRCAEIEGELKCLHGSIMINKEHVIEMDVTSENGQRALKEQSSKAKIVKNRWGRNVVQISNTDARCCVHDAACPANQFSGKSCGMFFSEGAKAQVAFKQIKAFMQALYPNAQTGHGHLLMPLRCECNSKPGHAPFLGRQLPKLTPFALSNAEDLDADLISDKSVLASVHHPALIVFQCCNPVYRNSRAQGGGPNCDFKISAPDLLNALVMVRSLWSENFTELPRMVVPEFKWSTKHQYRNVSLPVAHSDARQNPFDF |
| Construction | 174-529 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | Early E2A DNA-binding protein, Early 2A protein, DNA-binding protein, DBP |
| Research Background | Plays a role in the elongation phase of viral strand displacement replication by unwinding the template in an ATP-independent fashion, employing its capacity to form multimers. Also enhances the rate of initiation. Released from template upon second strand synthesis. Assembles in complex with viral pTP, viral pol, host NFIA and host POU2F1/OCT1 on viral origin of replication. Covers the whole ssDNA genome during synthesis. The complementary strand synthesis induces its relese from DNA template. May inhibit cellular transcription mediated by the interaction between host SRCAP and CBP. |
| Molecular Weight | 42.3 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Keywords
Early 2A-protein
Related Tags: Human adenovirus C serotype 5 DNA-binding protein (His) chemical structure | Human adenovirus C serotype 5 DNA-binding protein (His) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote

