KLF5 (Kruppel-like Factor 5, Basic Transcription Element Binding Protein 2, BTE-binding Protein 2, BTEB2, Colon Krueppel-like Factor, CKLF, GC Box Binding Protein 2, Intestinal-enriched Krueppel-like Factor, IKLF, Transcription Factor BTEB2) (APC)
Referentie 128855-APC-100ul
Formaat : 100ul
Merk : US Biological
128855-APC KLF5 (Kruppel-like Factor 5, Basic Transcription Element Binding Protein 2, BTE-binding Protein 2, BTEB2, Colon Krueppel-like Factor, CKLF, GC Box Binding Protein 2, Intestinal-enriched Krueppel-like Factor, IKLF, Transcription Factor BTEB2) (APC)
Clone Type
MonoclonalHost
mouseSource
humanIsotype
IgG2b,kGrade
Affinity PurifiedApplications
FLISA WBCrossreactivity
HuAccession #
NM_001730, NP_001721Shipping Temp
Blue IceStorage Temp
4°C Do Not FreezeKLF5 is a member of the Kruppel-like factor subfamily of zinc finger proteins. Since the protein localizes to the nucleus and binds the epidermal growth factor response element, the protein is thought to be a transcription factor.
Applications:
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution:
Optimal dilutions to be determined by the researcher.
AA Sequence:
RYNRRSNPDLEKRRIHYCDYPGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDELTRHYRKHTGAKPFQCGVCNRSFSRSDHLALHMKRHQN
Storage and Stability:
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.

