Mopeia virus Pre-GP-C Protein (hFc)
Referentie NB-64-127808-10ug
Formaat : 10ug
Merk : Neo Biotech
Product Information
| Biological Activity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Mopeia virus Pre-GP-C Protein (hFc) is expressed in Mammalian cell. The accession number is P19240. |
| Species | Mopeia virus (MOPV) |
| Expression System | HEK293 Cells |
| Tag | C-hFc |
| Accession Number | P19240 |
| Synonyms | Pre-GP-C,Pre-glycoprotein polyprotein GP complex,GP-C,GPC |
| Amino Acid | SIYKDNYEFFSLDLDMSSLNATMPLSCSKNNSHHYIQVGNETGLELTLTNTSIINHKFCNLSDAHRRNLYDKALMSILTTFHLSIPDFNQYEAMSCDFNGGKISVQYNLSHSNYVDAGNHCGTIANGIMDVFRRMYWSTSLSVASDISGTQCIQTDYKYLIIQNTSWEDHCMFSRPSPMGFLSLLSQRTRNFYISRRLLGLFTWTLSDSEGNDMPGGYCLTRSMLIGLDLKCFGNTAIAKCNQAHDEEFCDMLRLFDFNKQAISKLRSEVQQSINLINKAVNALINDQLVMRNHLRDLMGIPYCNYSKFWYLNDTRTGRTSLPKCWLVTNGSYLNETQFSTEIEQEANNMFTDMLRKEYEKRQSTTPLGLVD |
| Construction | 59-430 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Molecular Weight | 71.6 kDa (Predicted) |
| Endotoxin | Not tested. |
| Formulation | Lyophilized from PBS, 6% Trehalose, pH 7.4 |
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Stability & Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 151 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
Dose Conversion
You can also refer to dose conversion for different animals. More

