Prolactin Protein, Pig, Recombinant (His & SUMO)
Referentie TMPH-03122-1mg
Formaat : 1mg
Merk : TargetMol
Prolactin Protein, Pig, Recombinant (His & SUMO)
(Synonyms: Prolactin, PRL) Copy Product InfoProlactin acts primarily on the mammary gland by promoting lactation. Prolactin Protein, Pig, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 39.0 kDa and the accession number is P01238.
For research use only—not for human use. No sales to individuals. Use as intended only.
User Guide of Recombinant Proteins
Product Information
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Prolactin acts primarily on the mammary gland by promoting lactation. Prolactin Protein, Pig, Recombinant (His & SUMO) is expressed in E. coli expression system with N-6xHis-SUMO tag. The predicted molecular weight is 39.0 kDa and the accession number is P01238. |
| Species | Sus scrofa (Pig) |
| Expression System | E. coli |
| Tag | N-6xHis-SUMO |
| Accession Number | P01238 |
| Amino Acid | LPICPSGAVNCQVSLRDLFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFITKAINSCHTSSLSTPEDKEQAQQIHHEVLLNLILRVLRSWNDPLYHLVTEVRGMQEAPDAILSRAIEIEEQNKRLLEGMEKIVGQVHPGIKENEVYSVWSGLPSLQMADEDTRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIIYDSNC |
| Construction | 31-229 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | Prolactin, PRL |
| Research Background | Prolactin acts primarily on the mammary gland by promoting lactation. |
| Molecular Weight | 39.0 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | It is recommended to store recombinant proteins at -20°C to -80°C for future use. Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |