Recombinant human Interferon alpha-2
Referentie OPCA00279-1MG
Formaat : 1mg
Merk : Aviva Systems Biology
IFNA2 Recombinant Protein (Human) (OPCA00279)
| Datasheets/Manuals | Printable datasheet for IFNA2 Recombinant Protein (Human) (OPCA00279) |
|---|
| Predicted Species Reactivity | Homo sapiens|Human |
|---|---|
| Product Format | Liquid or Lyophilized powder |
| Additional Information | Tag information : His tag |
| Reconstitution and Storage | -20°C or -80°C |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Peptide Sequence | CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
| Protein Sequence | CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE |
| Storage Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source | E.coli |
| Protein Range | 24-188 aa |
| Tag | N-terminal GST-tagged |
| Reference | The consensus coding sequences of human breast and colorectal cancers.Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. , Gazdar A.F., Hartigan J., Wu L., Liu C., Parmigiani G., Park B.H., Bachman K.E., Papadopoulos N., Vogelstein B., Kinzler K.W., Velculescu V.E.Science 314:268-274(2006) |
|---|---|
| Gene Symbol | IFNA2 |
| Gene Full Name | interferon alpha 2 |
| Alias Symbols | alpha-2a interferon, IFN-alpha-2, IFN-alphaA, IFNA, IFNA2B, interferon alpha 2a, interferon alpha 2b, interferon alpha A, interferon alpha-2, Interferon alpha-A, leIF A. |
| NCBI Gene Id | 3440 |
| Protein Name | Interferon alpha-2 |
| Description of Target | Produced by macrophages, IFN-alpha have antiviral activities. |
| Uniprot ID | P01563 |
| Protein Size (# AA) | Full Length of Mature Protein |
| Molecular Weight | 46.2 kDa |







