Recombinant IFN beta 1a (Interferon beta 1a), Human, Animal-Free
Referentie orb1179086-5ug
Formaat : 5ug
Merk : Biorbyt
Recombinant IFN beta 1a (Interferon beta 1a), Human, AF
View Guide
Recombinant IFN beta 1b (Interferon beta 1b), Human, Animal-Free
SKU: orb1179086
Description
Research Area
Infectious Disease & Virology; Immunology & Inflammation
Key Properties
−| Expression System | Escherichia coli |
|---|---|
| Biological Origin | Human |
| Reactivity | Human |
| Tag | Polyhistidine tag |
| Endotoxins | <0.1 EU per 1 μg of the protein by the LAL method. |
| MW | The protein has a calculated MW of 20.84 kDa. The protein migrates as 15 kDa under reducing condition (SDS-PAGE analysis). |
| Purity | >98% as determined by SDS-PAGE. Ni-NTA chromatography. |
| Protein Sequence | MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN with polyhistidine tag at the C-terminus. |
Storage & Handling
−| Storage | Lyophilized: Store at -20°C or -80°C for 3 to 6 months. Initial Reconstitution: Store at 2°C to 8°C for up to 1 week. |
|---|---|
| Form/Appearance | Lyophilized |
| Buffer/Preservatives | The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0. |
| Reconstitution | Reconstitute the Lyophilized Protein in sterile H₂O to a concentration of 100-200 μg/mL. Then, incubate it at room temperature for at least 20 mins to ensure sufficient dissolution. Do Not Vortex! Vigorous shaking may impair the biological activity of the protein. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide


