Recombinant IFN gamma (Interferon gamma), Mouse, Animal-Free
Referentie orb1178973-100ug
Formaat : 100ug
Merk : Biorbyt
Recombinant IFN gamma (Interferon gamma), Mouse, AF
View GuideView Protocol
Recombinant IFN gamma (Interferon gamma), Mouse, Animal-Free
SKU: orb1178973
Description
Research Area
Infectious Disease & Virology; Immunology & Inflammation
Key Properties
−| Source | Escherichia coli |
|---|---|
| Expression System | Escherichia coli |
| Biological Origin | Mouse |
| Biological Activity | Measure by its ability to anti-viral assay in L-929 cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is <0.5 ng/mL. The specific activity of recombinant mouse IFN gamma is approximately >2x 106 IU/mg. |
| Reactivity | Mouse |
| Tag | His-tag at the N-terminus |
| Endotoxins | <0.01 EU per 1 μg of the protein by the LAL method. |
| Purity | >98% as determined by SDS-PAGE. Ni-NTA chromatography. |
| Protein Sequence | MHGTVIESLESLNNYFNSSGIDVEEKSLFLDIWRNWQKDGDMKILQSQIISFYLRLFEVLKDNQAISNNISVIESHLITTFFSNSKAKKDAFMSIAKFEVNNPQVQRQAFNELIRVVHQLLPESSLRKRKRSRC with polyhistidine tag at the C-terminus. |
Storage & Handling
−| Storage | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
|---|---|
| Form/Appearance | Lyophilized |
| Buffer/Preservatives | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
| Reconstitution | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
| Expiration Date | 6 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Type II interferon, T-cell interferon, MAF
Protocol Information
Protein Handling and Storage Guide
Protein Handling Guide
ELISA
Enzyme-linked Immunosorbent Assay (EIA)


