Recombinant Wheat Tri a 14/ltp157 Protein, N-GST & C-His

Referentie NB-21-32351

Formaat : 100µg

Merk : Neo Biotech


Recombinant Wheat Tri a 14/ltp157 Protein, N-GST & C-His

Product name ARO-P15707-100
Uniprot ID D2T2K2
Origin species Wheat
Expression system Prokaryotic expression
Raw Antigen Sequence ISCSQVDSTLMPCLQYVQQGGSPARGCCTGIQNLLAEANNSPDRRTICGCLKNVANGASGGPYITRAAALPSKCNVALPYKISPSVDCNTVH
Molecular weight 37.72 kDa
Protein delivered with Tag? N-Terminal GST & C-Terminal His Tag
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Host species Escherichia coli (E.coli)
Fragment Type Ile1-His92
Aliases /Synonyms Non-specific lipid-transfer protein, ltp157
Reference ARO-P15707
Note For research use only.
Molecular Constructor
GST Ile1–His92 His