SEC14L1 Antibody - N-terminal region - FITC
Referentie ARP65502_P050-FITC
Formaat : 100ul
Merk : Aviva Systems Biology
SEC14L1 Antibody - N-terminal region : FITC (ARP65502_P050-FITC)
| Datasheets/Manuals | Printable datasheet for anti-SEC14L1 (ARP65502_P050-FITC) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit |
|---|---|
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | FITC: Fluorescein Isothiocyanate |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human SEC14L1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 92%; Dog: 100%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: GSDTVNEFKSEDGAIHVIERRCKLDVDAPRLLKKIAGVDYVYFVQKNSLN |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-SEC14L1 (ARP65502_P050-FITC) antibody is Catalog # AAP65502 |
| Gene Symbol | SEC14L1 |
|---|---|
| Gene Full Name | SEC14-like 1 (S. cerevisiae) |
| Alias Symbols | SEC14L, PRELID4A |
| NCBI Gene Id | 6397 |
| Protein Name | SEC14-like protein 1 |
| Description of Target | The protein encoded by this gene belongs to the SEC14 cytosolic factor family. It has similarity to yeast SEC14 and to Japanese flying squid RALBP which suggests a possible role of the gene product in an intracellular transport system. Multiple alternatively spliced transcript variants have been found for this gene; some variants represent read-through transcripts that include exons from the upstream gene C17orf86. |
| Uniprot ID | Q92503 |
| Protein Accession # | NP_001137473 |
| Nucleotide Accession # | NM_001144001 |
| Protein Size (# AA) | 681 |
| Molecular Weight | 77kDa |
| Protein Interactions | UBC; EPB41; |
