SLC9A7 antibody - N-terminal region

Referentie ARP44066_P050

Formaat : 100ul

Merk : Aviva Systems Biology

Neem contact op met een lokale distributeur :


Telefoonnummer : +1 850 650 7790

Datasheets/ManualsPrintable datasheet for anti-SLC9A7 (ARP44066_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Dog, Goat, Guinea Pig, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human SLC9A7
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceDog: 100%; Goat: 85%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 100%
Peptide SequenceSynthetic peptide located within the following region: LGWGLRVAAAASASSSGAAAEDSSAMEELATEKEAEESHRQDSVSLLTFI
Concentration0.5 mg/ml
Blocking PeptideFor anti-SLC9A7 (ARP44066_P050) antibody is Catalog # AAP44066 (Previous Catalog # AAPP25512)
ReferenceLin,P.J., J. Cell. Sci. 118 (PT 9), 1885-1897 (2005)
Gene SymbolSLC9A7
Gene Full NameSolute carrier family 9, subfamily A (NHE7, cation proton antiporter 7), member 7
Alias SymbolsNHE7, NHE-7, MRX108, SLC9A6
NCBI Gene Id84679
Protein NameSodium/hydrogen exchanger 7
Description of TargetOrganelles of the secretory and endocytic pathways are distinguished by their luminal acidity, which is generated by the activity of an electrogenic vacuolar-type hydrogen ATPase. Progressive acidification of vesicles in the endocytic pathway is essential for the redistribution and degradation of internalized membrane proteins, such as ligand receptor complexes and fluid-phase solutes. It may play an important role in maintaining cation homeostasis and function of the trans-Golgi network.Organelles of the secretory and endocytic pathways are distinguished by their luminal acidity, which is generated by the activity of an electrogenic vacuolar-type hydrogen ATPase. Progressive acidification of vesicles in the endocytic pathway is essential for the redistribution and degradation of internalized membrane proteins, such as ligand receptor complexes and fluid-phase solutes. This gene is expressed predominantly in the trans-Golgi network, and mediates the influx of sodium or potassium in exchange for hydrogen. It may thus play an important role in maintaining cation homeostasis and function of the trans-Golgi network. This gene is part of a gene cluster on chromosome Xp11.23.Organelles of the secretory and endocytic pathways are distinguished by their luminal acidity, which is generated by the activity of an electrogenic vacuolar-type hydrogen ATPase. Progressive acidification of vesicles in the endocytic pathway is essential for the redistribution and degradation of internalized membrane proteins, such as ligand receptor complexes and fluid-phase solutes. This gene is expressed predominantly in the trans-Golgi network, and mediates the influx of sodium or potassium in exchange for hydrogen. It may thus play an important role in maintaining cation homeostasis and function of the trans-Golgi network. This gene is part of a gene cluster on chromosome Xp11.23.
Uniprot IDQ96T83
Protein Accession #NP_115980
Nucleotide Accession #NM_032591
Protein Size (# AA)725
Molecular Weight80kDa
Protein InteractionsUBC; SCAMP5; SCAMP2; SCAMP1; SLC9A7;
  1. What is the species homology for "SLC9A7 Antibody - N-terminal region (ARP44066_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Dog, Goat, Guinea Pig, Rabbit, Zebrafish".

  2. How long will it take to receive "SLC9A7 Antibody - N-terminal region (ARP44066_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "SLC9A7 Antibody - N-terminal region (ARP44066_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "SLC9A7 Antibody - N-terminal region (ARP44066_P050)"?

    This target may also be called "NHE7, NHE-7, MRX108, SLC9A6" in publications.

  5. What is the shipping cost for "SLC9A7 Antibody - N-terminal region (ARP44066_P050)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "SLC9A7 Antibody - N-terminal region (ARP44066_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "SLC9A7 Antibody - N-terminal region (ARP44066_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "80kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "SLC9A7 Antibody - N-terminal region (ARP44066_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "SLC9A7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "SLC9A7"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "SLC9A7"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "SLC9A7"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "SLC9A7"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "SLC9A7"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Misschien heeft u ook interesse in de volgende producten:



Referentie
Beschrijving
Cond.
Price Bef. VAT
CPA2905-30ul
 30ul 
CPA2488-30ul
 30ul 
A11831-1
 100ul