TRIM65 Protein, Human, Recombinant (His)
Referentie NB-64-166734-100ug
Formaat : 100ug
Merk : Neo Biotech
Remove All
TRIM65 Protein, Human, Recombinant (His)
(Synonyms: Tripartite motif-containing protein 65, TRIM65, E3 ubiquitin-protein ligase TRIM65) Copy Product InfoSynonyms: Tripartite motif-containing protein 65, TRIM65, E3 ubiquitin-protein ligase TRIM65
Catalog No. TMPH-03777 Copy Product Info
TRIM65 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q6PJ69.
For research use only—not for human use. No sales to individuals. Use as intended only.
Select Batch
Purity:88%
Appearance:Lyophilized powder
Color:Transparent
Contact us for more batch information
Product Introduction
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. |
| Description | TRIM65 Protein, Human, Recombinant (His) is expressed in E. coli. The accession number is Q6PJ69. |
| Species | Human |
| Expression System | Yeast |
| Tag | C-6xHis |
| Accession Number | P43003 |
| Amino Acid | HPGKGTKENMHREGKIVRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLVGAVINNVSEAMETLTRITEELVPVPG |
| Construction | 146-236 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4 |
| Reconstitution | Reconstitute the lyophilized protein in distilled water. The product concentration should not be less than 100 μg/ml. Before opening, centrifuge the tube to collect powder at the bottom. After adding the reconstitution buffer, avoid vortexing or pipetting for mixing. |
| Synonyms | Tripartite motif-containing protein 65, TRIM65, E3 ubiquitin-protein ligase TRIM65 |
| Molecular Weight | 64.1 kDa (Predicted); 66 kDa (Reducing conditions) |
| Relative Density. | no data available |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | It is recommended to store recombinant proteins at -20°C to -80°C for future use. Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Keywords
TRIM65Protein,Human,Recombinant(His)
Related Tags: TRIM65 Protein, Human, Recombinant (His) chemical structure | TRIM65 Protein, Human, Recombinant (His) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote


