PTX17851
Formaat : 50ug
| Product name | U1 small nuclear ribonucleoprotein C(SNRPC) |
|---|---|
| Uniprot ID | F6TFD9 |
| Uniprot link | https://www.uniprot.org/uniprot/F6TFD9 |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAPPPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMRPPARPMMVPTRPGMTRPDR |
| Molecular weight | 18.3kDa |
| Protein delivered with Tag? | N-terminal His Tag |
| Purity estimated | >60% by SDS-PAGE |
| Buffer | 20 mM Tris-HCl,pH8.0, 100mM NaCl, 1mM DTT, 0.1mM EDTA, 10%glycerol,0.1%NaN3 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Met1-Arg159 |
| Protein Accession | F6TFD9 |
| NCBI Reference | F6TFD9 |
| Aliases /Synonyms | U1 snRNP C,SNRPC,U1-C,U1C |
| Reference | PX-P4599 |
| Note | For research use only |
| Molecular Constructor | His Met1–Arg159 |
| Product name | U1 small nuclear ribonucleoprotein C(SNRPC) |
|---|---|
| Uniprot ID | F6TFD9 |
| Uniprot link | https://www.uniprot.org/uniprot/F6TFD9 |
| Expression system | Prokaryotic expression |
| Raw Antigen Sequence | MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAPPPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMRPPARPMMVPTRPGMTRPDR |
| Molecular weight | 18.3kDa |
| Protein delivered with Tag? | N-terminal His Tag |
| Purity estimated | >60% by SDS-PAGE |
| Buffer | 20 mM Tris-HCl,pH8.0, 100mM NaCl, 1mM DTT, 0.1mM EDTA, 10%glycerol,0.1%NaN3 |
| Delivery condition | Dry Ice |
| Delivery lead time in business days | Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days |
| Storage condition | 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection) |
| Brand | ProteoGenix |
| Host species | Escherichia coli (E.coli) |
| Fragment Type | Met1-Arg159 |
| Protein Accession | F6TFD9 |
| NCBI Reference | F6TFD9 |
| Aliases /Synonyms | U1 snRNP C,SNRPC,U1-C,U1C |
| Reference | PX-P4599 |
| Note | For research use only |
| Molecular Constructor | His Met1–Arg159 |
PTX17851
There are no reviews yet.