Images
QC Test

  • Specification

    Product Description

    Human UBXD7 full-length ORF ( AAH47420.1, 1 a.a. - 309 a.a.) recombinant protein with GST-tag at N-terminal.Full-Length Protein,Full-Length Proteins,Full-Length,Full Length,FullLength

    Sequence

    MAAHGGSAASSALKGLIQQFTTITGASESVGKHMLEACNNNLEMAVTMFLDGGGIAEEPSTSSASVSTVRPHTEEEVRAPIPQKQEILVEPEPLFGAPKRRRPARSIFDGFRDFQTETIRQEQELRNGGAIDKKLTTLADLFRPPIDLMHKGSFETAKECGQMQNKWLMINIQNVQDFACQCLNRDVWSNEAVKNIIREHFIFWQVYHDSEEGQRYIQFYKLGDFPYVSILDPRTGQKLVEWHQLDVSSFLDQVTGFLGEHGQLDGLSSSPPKKCARSESLIDASEDSQLEAAIRASLQETHFDSTQTK

    Host

    Wheat Germ (in vitro)

    Theoretical MW (kDa)

    61

    Interspecies Antigen Sequence

    Mouse (99)

    Preparation Method

    in vitro wheat germ expression system

    Purification

    Glutathione Sepharose 4 Fast Flow

    Quality Control Testing

    12.5% SDS-PAGE Stained with Coomassie Blue.

    Storage Buffer

    50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

    Storage Instruction

    Store at -80°C. Aliquot to avoid repeated freezing and thawing.

    Note

    Best use within three months from the date of receipt of this protein.

  • Applications

    Enzyme-linked Immunoabsorbent Assay

    Western Blot (Recombinant protein)

    Antibody Production

    Protein Array

  • Gene Info — UBXN7

    Entrez GeneID

    26043

    GeneBank Accession#

    BC047420.1

    Protein Accession#

    AAH47420.1

    Gene Name

    UBXN7

    Gene Alias

    KIAA0794, UBXD7

    Gene Description

    UBX domain protein 7

    Gene Ontology

    Hyperlink

    Other Designations

    UBX domain containing 7

  • Interactome