YRDC Rabbit Polyclonal Antibody

Referentie TA337984

Formaat : 100ul


YRDC Rabbit Polyclonal Antibody

Be the first to review this product
SKU
TA337984
Rabbit Polyclonal Anti-YRDC Antibody
 
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-YRDC antibody is: synthetic peptide directed towards the middle region of Human YRDC. Synthetic peptide located within the following region: VPEGLLKDLLPGPVTLVMERSEELNKDLNPFTPLVGIRIPDHAFMQDLAQ
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 24 kDa
Gene Name yrdC N6-threonylcarbamoyltransferase domain containing
Database Link
Background YRDC may regulate the activity of some transporters.
Synonyms DRIP3; IRIP; SUA5
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 83%; Zebrafish: 79%
Reference Data
Protein Categories Intracellular Proteins

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Misschien heeft u ook interesse in de volgende producten:



Referentie
Beschrijving
Cond.
Price Bef. VAT
TA314288
 100ul