Anti-Human DLG4/PSD95 Antibody (K28/74)

Referentie NB-21-39674

Formaat : 100µg

Merk : Neo Biotech


Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US (" height="17" viewBox="0 0 17 17" fill="none" xmlns="http://www.w3.org/2000/svg"> Close

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Close
Clonality:
Polyclonal Antibody
Host species:
Rabbit
Isotype:
IgG

Specifications Anti-Human TBX6 Polyclonal Antibody

Product name ARO-A19446-100
Uniprot ID O95947
Raw Antigen Sequence GVSLSLENRELWKEFSSVGTEMIITKAGRRMFPACRVSVTGLDPEARYLFLLDVIPVDGARYRWQGRRWEPSGKAEPRLPDRVYIHPDSPATGAHWMRQPVSFHRVKLTNSTLDPHGHLILHSMHKYQPRIHLVRAAQLCSQHWGGMASFRFPETTFISVTAYQNPQITQLKIAANPFAKGFRENGRNCKRERDARVKRK
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-TBX6
Isotype IgG
Clonality Polyclonal Antibody
Protein Name TBX6
Dilution ELISA: 1:4000-1:8000, IHC: 1:50-1:100, WB: 1:1000-1:4000
Product name ARO-A19446-1MG
Uniprot ID O95947
Raw Antigen Sequence GVSLSLENRELWKEFSSVGTEMIITKAGRRMFPACRVSVTGLDPEARYLFLLDVIPVDGARYRWQGRRWEPSGKAEPRLPDRVYIHPDSPATGAHWMRQPVSFHRVKLTNSTLDPHGHLILHSMHKYQPRIHLVRAAQLCSQHWGGMASFRFPETTFISVTAYQNPQITQLKIAANPFAKGFRENGRNCKRERDARVKRK
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-TBX6
Isotype IgG
Clonality Polyclonal Antibody
Protein Name TBX6
Dilution ELISA: 1:4000-1:8000, IHC: 1:50-1:100, WB: 1:1000-1:4000
Product name ARO-A19446-50
Uniprot ID O95947
Raw Antigen Sequence GVSLSLENRELWKEFSSVGTEMIITKAGRRMFPACRVSVTGLDPEARYLFLLDVIPVDGARYRWQGRRWEPSGKAEPRLPDRVYIHPDSPATGAHWMRQPVSFHRVKLTNSTLDPHGHLILHSMHKYQPRIHLVRAAQLCSQHWGGMASFRFPETTFISVTAYQNPQITQLKIAANPFAKGFRENGRNCKRERDARVKRK
Delivery condition Blue ice (+4°C)
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), store at -20°C to -80°C for long term(1 year); Avoid repeated freeze-thaw cycles
Brand ProteoGenix
Host species Rabbit
Aliases /Synonyms Anti-TBX6
Isotype IgG
Clonality Polyclonal Antibody
Protein Name TBX6
Dilution ELISA: 1:4000-1:8000, IHC: 1:50-1:100, WB: 1:1000-1:4000

Documents

QC & Validation

Anti-Human TBX6 Polyclonal Antibody binds to Recombinant Human TBX6 Protein, N-His in WB Assay

Anti-Human TBX6 Polyclonal Antibody binds to Recombinant Human TBX6 Protein, N-His in WB Assay

Recombinant Human TBX6 Protein, N-His(cat. No.ARO-P16064) can bind Anti-Human TBX6 Polyclonal Antibody in Western Blot Assay as detected on gel analysis.

Reviews

There are no reviews yet.

Be the first to review “Anti-Human TBX6 Polyclonal Antibody” Cancel reply

Recently viewed products

Loading recently viewed products…

Can’t find what you need?

Our catalog doesn’t cover everything — but our team does. Whether you need a custom antibody, a specific protein variant, or a bulk order, our scientists are here to help.

Contact Our Team Book a Call