MEIS1 Antibody - C-terminal region : HRP
Referentie ARP38149_P050-HRP
Formaat : 100ul
Merk : Aviva Systems Biology
Neem contact op met een lokale distributeur :
Telefoonnummer : +1 850 650 7790
MEIS1 Antibody - C-terminal region : HRP (ARP38149_P050-HRP)
| Datasheets/Manuals | Printable datasheet for anti-MEIS1 (ARP38149_P050-HRP) antibody |
|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
|---|---|
| Product Format | Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugation | HRP: Horseradish Peroxidase |
| Application | WB |
| Reconstitution and Storage | All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human MEIS1 |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: AVSQGTPYNPDGQPMGGFVMDGQQHMGIRAPGPMSGMGMNMGMEGQWHYM |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-MEIS1 (ARP38149_P050-HRP) antibody is Catalog # AAP38149 (Previous Catalog # AAPS04902) |
| Reference | Robinson,B.W., (2008) Blood 111 (7), 3802-3812 |
|---|---|
| Gene Symbol | MEIS1 |
| Gene Full Name | Meis homeobox 1 |
| Alias Symbols | MGC43380 |
| NCBI Gene Id | 4211 |
| Protein Name | Homeobox protein Meis1 |
| Description of Target | Homeobox genes, of which the most well-characterized category is represented by the HOX genes, play a crucial role in normal development. In addition, several homeoproteins are involved in neoplasia. MEIS1 is a homeobox protein belonging to the TALE ('three amino acid loop extension') family of homeodomain-containing proteins.Homeobox genes, of which the most well-characterized category is represented by the HOX genes, play a crucial role in normal development. In addition, several homeoproteins are involved in neoplasia. This gene encodes a homeobox protein belonging to the TALE ('three amino acid loop extension') family of homeodomain-containing proteins. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
| Uniprot ID | O00470 |
| Protein Accession # | NP_002389 |
| Nucleotide Accession # | NM_002398 |
| Protein Size (# AA) | 390 |
| Molecular Weight | 43kDa |
| Protein Interactions | ETS1; TRMT10B; CRTC1; CREBBP; CREB1; SUMO2; Cebpb; PBX1; HOXC11; TLX2; EMX2; PBX3; HOXB4; TLX3; HOXA2; HOXB13; PKNOX1; TLX1; HOXD13; HOXD12; HOXD11; HOXD4; HOXC13; HOXB1; HOXB8; HOXA13; HOXA11; HOXA10; HOXA9; HOXA5; HOXA7; HOXD9; |
