NPY2R Protein, Mouse, Recombinant (His)
Referentie NB-64-51478-5ug
Formaat : 5ug
Merk : Neo Biotech
Remove All
NPY2R Protein, Mouse, Recombinant (His)
(Synonyms: NPY-Y2 receptor (Y2 receptor), NPY2-R, Npy2r, Neuropeptide Y receptor type 2) Copy Product InfoSynonyms: NPY-Y2 receptor (Y2 receptor), NPY2-R, Npy2r, Neuropeptide Y receptor type 2
Catalog No. TMPH-02809 Copy Product Info
Receptor for neuropeptide Y and peptide YY. NPY2R Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 11.0 kDa and the accession number is P97295.
For research use only—not for human use. No sales to individuals. Use as intended only.
Product Information
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Receptor for neuropeptide Y and peptide YY. NPY2R Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-10xHis tag. The predicted molecular weight is 11.0 kDa and the accession number is P97295. |
| Species | Mouse |
| Expression System | E. coli |
| Tag | N-10xHis |
| Accession Number | P97295 |
| Amino Acid | MGPVGAEADENQTVEVKVEPYGPGHTTPRGELPPDPEPELIDSTKLVEVQV |
| Construction | 1-51 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | NPY-Y2 receptor (Y2 receptor), NPY2-R, Npy2r, Neuropeptide Y receptor type 2 |
| Research Background | Receptor for neuropeptide Y and peptide YY. |
| Molecular Weight | 11.0 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Keywords
Y2-receptorY2 receptor
Related Tags: NPY2R Protein, Mouse, Recombinant (His) chemical structure | NPY2R Protein, Mouse, Recombinant (His) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote

