PSEN2 antibody
Referentie orb579119-100ul
Formaat : 100ul
Merk : Biorbyt
Neem contact op met een lokale distributeur :
Telefoonnummer : +1 850 650 7790
PSEN2 antibody
Catalog Number: orb579119
| Catalog Number | orb579119 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to PSEN2 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | IHC, WB |
| Predicted Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish |
| Reactivity | Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rat, Zebrafish |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PSEN2 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 49kDa |
| Target | PSEN2 |
| UniProt ID | P49810 |
| Protein Sequence | Synthetic peptide located within the following region: VVVATIKSVRFYTEKNGQLIYTPFTEDTPSVGQRLLNSVLNTLIMISVIV |
| NCBI | NP_000438 |
| Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | AD4, PS2, AD3L, STM2, CMD1V |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |