Reagentia en instrumenten voor immunologie, celbiologie en moleculaire biologie.
 
> Recombinant Human WNT1 Protein, N-His

Recombinant Human WNT1 Protein, N-His

Afdrukken Afdrukken
Log in alstublieft

Referentie NB-21-32164

Formaat : 100µg

Merk : Neo Biotech


Skip to main content

It looks like you are visiting from outside the EU. Switch to the US version to see local pricing in USD and local shipping.

Switch to US (" height="17" viewBox="0 0 17 17" fill="none" xmlns="http://www.w3.org/2000/svg"> Close
Contact +33 (0)3 90 20 54 70

📢 ProteoGenix Loyalty Program is live — Earn points on every online order. Discover the program

Get 25% off your first bioreagent online order — use code: PROTEOSHOP25

Close
Host species:
Escherichia coli (E.coli)
Origin species:
Human
Uniprot ID:
P04628
Molecular weight:
27.44 kDa
Gly32–Arg255
Recombinant Human WNT1 Protein, N-His

Specifications Recombinant Human WNT1 Protein, N-His

Product name ARO-P11618-100
Uniprot ID P04628
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GRWWGIVNVASSTNLLTDSKSLQLVLEPSLQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASR
Molecular weight 27.44 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly32-Arg255
Aliases /Synonyms WNT1, Proto-oncogene Wnt-1, INT1, Proto-oncogene Int-1 homolog
Reference ARO-P11618
Note For research use only.
Molecular Constructor
Gly32–Arg255
Product name ARO-P11618-1MG
Uniprot ID P04628
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GRWWGIVNVASSTNLLTDSKSLQLVLEPSLQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASR
Molecular weight 27.44 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly32-Arg255
Aliases /Synonyms WNT1, Proto-oncogene Wnt-1, INT1, Proto-oncogene Int-1 homolog
Reference ARO-P11618
Note For research use only.
Molecular Constructor
Gly32–Arg255
Product name ARO-P11618-50
Uniprot ID P04628
Origin species Human
Expression system Prokaryotic expression
Raw Antigen Sequence GRWWGIVNVASSTNLLTDSKSLQLVLEPSLQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRGCRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLFGREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLRAVGDVLRDRFDGASR
Molecular weight 27.44 kDa
Buffer Lyophilized from a solution in PBS pH 7.4, 0.02% NLS, 1mM EDTA, 4% Trehalose, 1% Mannitol.
Delivery condition Dry Ice
Delivery lead time in business days 3-5 days if in stock; 3-5 weeks if production needed
Storage condition 4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand ProteoGenix
Host species Escherichia coli (E.coli)
Fragment Type Gly32-Arg255
Aliases /Synonyms WNT1, Proto-oncogene Wnt-1, INT1, Proto-oncogene Int-1 homolog
Reference ARO-P11618
Note For research use only.
Molecular Constructor
Gly32–Arg255

Documents

3D Representation

Recombinant Human WNT1 Protein, N-His

Reviews

There are no reviews yet.

Be the first to review “Recombinant Human WNT1 Protein, N-His” Cancel reply

Related products

  • ARO-A11820

    Anti-Human WNT1 Polyclonal Antibody