Tenomodulin Protein, Mouse, Recombinant (His)
Referentie NB-64-51596-1mg
Formaat : 1mg
Merk : Neo Biotech
Remove All
Tenomodulin Protein, Mouse, Recombinant (His)
(Synonyms: Tnmd, Tenomodulin, Tendin, TeM, Myodulin, mTeM, Chondromodulin-I-like protein, Chondromodulin-1-like protein (ChM1L;mChM1L), Chm1l) Copy Product InfoSynonyms: Tnmd, Tenomodulin, Tendin, TeM, Myodulin, mTeM, Chondromodulin-I-like protein, Chondromodulin-1-like protein (ChM1L;mChM1L), Chm1l
Catalog No. TMPH-02927 Copy Product Info
May be an angiogenesis inhibitor. Tenomodulin Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 35.6 kDa and the accession number is Q9EP64.
For research use only—not for human use. No sales to individuals. Use as intended only.
Product Information
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | May be an angiogenesis inhibitor. Tenomodulin Protein, Mouse, Recombinant (His) is expressed in E. coli expression system with N-6xHis tag. The predicted molecular weight is 35.6 kDa and the accession number is Q9EP64. |
| Species | Mouse |
| Expression System | E. coli |
| Tag | N-6xHis |
| Accession Number | Q9EP64 |
| Amino Acid | KHFWPEVSKKTYDMEHTFYSNGEKKKIYMEIDPITRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKCFIKTQIKVIPEFSEPEEEIDENEEITTTFFEQSVIWVPAEKPIENRDFLKNSKILEICDNVTMYWINPTLIAVSELQDFEEDGEDLHFPTSEKKGIDQNEQWVVPQVKVEKTRHTRQASEEDLPINDYTENGIEFDPMLDERGYCCIYCRRGNRYCRRVCEPLLGYYPYPYCYQGGRVICRVIMPCNWWVARMLGRV |
| Construction | 51-317 aa |
| Protein Purity | > 85% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | Tnmd, Tenomodulin, Tendin, TeM, Myodulin, mTeM, Chondromodulin-I-like protein, Chondromodulin-1-like protein (ChM1L;mChM1L), Chm1l |
| Research Background | May be an angiogenesis inhibitor. |
| Molecular Weight | 35.6 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Keywords
ChM-1LChM1L
Related Tags: Tenomodulin Protein, Mouse, Recombinant (His) chemical structure | Tenomodulin Protein, Mouse, Recombinant (His) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote

