Carnitine O-palmitoyltransferase 1, liver isoform(CPT1A)

Specifications Carnitine O-palmitoyltransferase 1, liver isoform(CPT1A)

Product name	Carnitine O-palmitoyltransferase 1, liver isoform(CPT1A)
Uniprot ID	P50416
Uniprot link	https://www.uniprot.org/uniprot/P50416
Expression system	Prokaryotic expression
Raw Antigen Sequence	QSLDAVEKAAFFVTLDETEEGYRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTGSGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLINFHISSKFSCPET
Molecular weight	38.45 kDa
Protein delivered with Tag?	N-terminal His Tag
Purity estimated	>90%by SDS-PAGE
Buffer	PBS pH 7.5, 0.02% SKL
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Gln406-Thr745
Protein Accession	P50416
Spec:Entrez GeneID	1374
Spec:NCBI Gene Aliases	CPT1; CPT1-L; L-CPT1
Spec:SwissProtID	Q8TCU0
NCBI Reference	P50416
Aliases /Synonyms	CPT1-L,Carnitine O-palmitoyltransferase I, liver isoform,CPT I,CPTI-L,Carnitine palmitoyltransferase 1A,CPT1A,CPT1
Reference	PX-P4721
Note	For research use only
Molecular Constructor	His Gln406–Thr745

Product name	Carnitine O-palmitoyltransferase 1, liver isoform(CPT1A)
Uniprot ID	P50416
Uniprot link	https://www.uniprot.org/uniprot/P50416
Expression system	Prokaryotic expression
Raw Antigen Sequence	QSLDAVEKAAFFVTLDETEEGYRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTGSGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLINFHISSKFSCPET
Molecular weight	38.45 kDa
Protein delivered with Tag?	N-terminal His Tag
Purity estimated	>90%by SDS-PAGE
Buffer	PBS pH 7.5, 0.02% SKL
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Gln406-Thr745
Protein Accession	P50416
Spec:Entrez GeneID	1374
Spec:NCBI Gene Aliases	CPT1; CPT1-L; L-CPT1
Spec:SwissProtID	Q8TCU0
NCBI Reference	P50416
Aliases /Synonyms	CPT1-L,Carnitine O-palmitoyltransferase I, liver isoform,CPT I,CPTI-L,Carnitine palmitoyltransferase 1A,CPT1A,CPT1
Reference	PX-P4721
Note	For research use only
Molecular Constructor	His Gln406–Thr745

Product name	PX-P4721-1MG
Uniprot ID	P50416
Uniprot link	https://www.uniprot.org/uniprot/P50416
Expression system	Prokaryotic expression
Raw Antigen Sequence	QSLDAVEKAAFFVTLDETEEGYRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPIVAHLWEYVMSIDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLANDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREGRTETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTGSGIDRHLFCLYVVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYGVSYILVGENLINFHISSKFSCPET
Molecular weight	38.45 kDa
Protein delivered with Tag?	N-terminal His Tag
Purity estimated	>90%by SDS-PAGE
Buffer	PBS pH 7.5, 0.02% SKL
Delivery condition	Dry Ice
Delivery lead time in business days	Europe: 5-7 working days USA & Canada: 7-10 working days Rest of the world: 5-12 working days
Storage condition	4°C for short term (1 week), -20°C or -80°C for long term (avoid freezing/thawing cycles; addition of 20-40% glycerol improves cryoprotection)
Brand	ProteoGenix
Host species	Escherichia coli (E.coli)
Fragment Type	Gln406-Thr745
Protein Accession	P50416
Spec:Entrez GeneID	1374
Spec:NCBI Gene Aliases	CPT1; CPT1-L; L-CPT1
Spec:SwissProtID	Q8TCU0
NCBI Reference	P50416
Aliases /Synonyms	CPT1-L,Carnitine O-palmitoyltransferase I, liver isoform,CPT I,CPTI-L,Carnitine palmitoyltransferase 1A,CPT1A,CPT1
Reference	PX-P4721
Note	For research use only
Molecular Constructor	His Gln406–Thr745

Documents

• Datasheet
• MSDS

3D Representation

Reviews

There are no reviews yet.

Be the first to review “Carnitine O-palmitoyltransferase 1, liver isoform(CPT1A)” Cancel reply