CMAS antibody - N-terminal region
Referentie ARP48845_P050
Formaat : 100ul
Merk : Aviva Systems Biology
CMAS Antibody - N-terminal region (ARP48845_P050)
| Datasheets/Manuals | Printable datasheet for anti-CMAS (ARP48845_P050) antibody |
|---|
| Tested Species Reactivity | Human |
|---|---|
| Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish |
| Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Application | WB |
| Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CMAS |
| Purification | Affinity Purified |
| Predicted Homology Based on Immunogen Sequence | Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100% |
| Peptide Sequence | Synthetic peptide located within the following region: GRGVEKPPHLAALILARGGSKGIPLKNIKHLAGVPLIGWVLRAALDSGAF |
| Concentration | 0.5 mg/ml |
| Blocking Peptide | For anti-CMAS (ARP48845_P050) antibody is Catalog # AAP48845 (Previous Catalog # AAPP28894) |
| Reference | Kutsenko,A.S., (2002) Nucleic Acids Res. 30 (14), 3163-3170 |
|---|---|
| Gene Symbol | CMAS |
| Gene Full Name | Cytidine monophosphate N-acetylneuraminic acid synthetase |
| Alias Symbols | CSS |
| NCBI Gene Id | 55907 |
| Protein Name | N-acylneuraminate cytidylyltransferase |
| Description of Target | CMAS is an enzyme that catalyzes the activation of Neu5Ac to Cytidine 5-prime-monophosphate N-acetylneuraminic acid (CMP-Neu5Ac), which provides the substrate required for the addition of sialic acid. Sialic acids of cell surface glycoproteins and glycolipids play a pivotal role in the structure and function of animal tissues. The pattern of cell surface sialylation is highly regulated during embryonic development, and changes with stages of differentiation. Studies of a similar murine protein suggest that this protein localizes to the nucleus.The enzyme encoded by this gene catalyzes the activation of Neu5Ac to Cytidine 5-prime-monophosphate N-acetylneuraminic acid (CMP-Neu5Ac), which provides the substrate required for the addition of sialic acid. Sialic acids of cell surface glycoproteins and glycolipids play a pivotal role in the structure and function of animal tissues. The pattern of cell surface sialylation is highly regulated during embryonic development, and changes with stages of differentiation. Studies of a similar murine protein suggest that this protein localizes to the nucleus. |
| Uniprot ID | Q8NFW8 |
| Protein Accession # | NP_061156 |
| Nucleotide Accession # | NM_018686 |
| Protein Size (# AA) | 434 |
| Molecular Weight | 48kDa |
| Protein Interactions | SUMO2; SUMO3; UBC; FBXO6; APP; SIGLEC12; |




