Cpne6 Antibody - C-terminal region - Biotin

Referentie ARP59454_P050-Biotin

Formaat : 100ul

Merk : Aviva Systems Biology


Cpne6 Antibody - C-terminal region : Biotin (ARP59454_P050-Biotin)

Datasheets/ManualsPrintable datasheet for anti-Cpne6 (ARP59454_P050-Biotin) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Sheep, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer.
ClonalityPolyclonal
HostRabbit
ConjugationBiotin
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 93%; Zebrafish: 93%
Peptide SequenceSynthetic peptide located within the following region: YLQALRTVGGICQDYDSDKRFPAFGFGARIPPNFEVSHDFAINFDPENPE
Concentration0.5 mg/ml
Blocking PeptideFor anti-Cpne6 (ARP59454_P050-Biotin) antibody is Catalog # AAP59454 (Previous Catalog # AAPP45553)
Gene SymbolCpne6
Gene Full NameCopine VI
Alias SymbolsAU067659, BB076446
NCBI Gene Id12891
Protein NameCopine-6
Description of TargetCalcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene is one of several genes that encodes a calcium-dependent protein containing two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. Three transcript variants encoding two different isoforms have been found for this gene.
Uniprot IDQ9Z140
Protein Accession #NP_034077
Nucleotide Accession #NM_009947
Protein Size (# AA)557
Molecular Weight62kDa
Protein InteractionsEed; Os9;