Human adenovirus C serotype 5 Protease (His & Myc)
Referentie NB-64-49580-10ug
Formaat : 10ug
Merk : Neo Biotech
Remove All
Human adenovirus C serotype 5 Protease (His & Myc)
(Synonyms: Protease, L3, Endoprotease, Adenovirus proteinase, Adenovirus protease (AVP), Adenain) Copy Product InfoSynonyms: Protease, L3, Endoprotease, Adenovirus proteinase, Adenovirus protease (AVP), Adenain
Catalog No. TMPH-00902 Copy Product Info
Human adenovirus C serotype 5 Protease (His & Myc) is expressed in E. coli.
For research use only—not for human use. No sales to individuals. Use as intended only.
Product Information
Bioactivity
Chemical Properties
Storage & Solubility Information
| Bioactivity | Activity has not been tested. It is theoretically active, but we cannot guarantee it. If you require protein activity, we recommend choosing the eukaryotic expression version first. |
| Description | Human adenovirus C serotype 5 Protease (His & Myc) is expressed in E. coli. |
| Species | HAdV-5 |
| Expression System | E. coli |
| Tag | N-10xHis, C-Myc |
| Accession Number | P03253 |
| Amino Acid | MGSSEQELKAIVKDLGCGPYFLGTYDKRFPGFVSPHKLACAIVNTAGRETGGVHWMAFAWNPHSKTCYLFEPFGFSDQRLKQVYQFEYESLLRRSAIASSPDRCITLEKSTQSVQGPNSAACGLFCCMFLHAFANWPQTPMDHNPTMNLITGVPNSMLNSPQVQPTLRRNQEQLYSFLERHSPYFRSHSAQIRSATSFCHLKNM |
| Construction | 1-204 aa |
| Protein Purity | > 90% as determined by SDS-PAGE. |
| Endotoxin | < 1.0 EU/μg of the protein as determined by the LAL method. |
| Formulation | Tris-based buffer, 50% glycerol |
| Reconstitution | A Certificate of Analysis (CoA) containing reconstitution instructions is included with the products. Please refer to the CoA for detailed information. |
| Synonyms | Protease, L3, Endoprotease, Adenovirus proteinase, Adenovirus protease (AVP), Adenain |
| Research Background | Cleaves viral precursor proteins (pTP, pIIIa, pVI, pVII, pVIII, and pX) inside newly assembled particles giving rise to mature virions. Protease complexed to its cofactor slides along the viral DNA to specifically locate and cleave the viral precursors. Mature virions have a weakened organization compared to the unmature virions, thereby facilitating subsequent uncoating. Without maturation, the particle lacks infectivity and is unable to uncoat. Late in adenovirus infection, in the cytoplasm, may participate in the cytoskeleton destruction. Cleaves host cell cytoskeletal keratins K7 and K18. |
| Molecular Weight | 28.1 kDa (predicted) |
| Shipping | In general, lyophilized powders are shipped with blue ice, while solutions are shipped with dry ice. |
| Storage | Lyophilized powders can be stably stored for over 12 months, while liquid products can be stored for 6-12 months at -80°C. For reconstituted protein solutions, the solution can be stored at -20°C to -80°C for at least 3 months. Please avoid multiple freeze-thaw cycles and store products in aliquots. |
Calculator
Dose Conversion
Keywords
L 3AVP
Related Tags: Human adenovirus C serotype 5 Protease (His & Myc) chemical structure | Human adenovirus C serotype 5 Protease (His & Myc) molecular weight
Generate Quote
Catalog No.: Cas No.:
Add
| Size | Quantity | Unit Price | Amount | Operation |
|---|
Generate Quote

