MCM8 antibody - N-terminal region

Referentie ARP36694_P050

Formaat : 100ul

Merk : Aviva Systems Biology

Neem contact op met een lokale distributeur :


Telefoonnummer : +1 850 650 7790

Datasheets/ManualsPrintable datasheet for anti-MCM8 (ARP36694_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human MCM8
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 91%; Dog: 93%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Peptide SequenceSynthetic peptide located within the following region: RFIPYKGWKLYFSEVYSDSSPLIEKIQAFEKFFTRHIDLYDKDEIERKGS
Concentration0.5 mg/ml
Blocking PeptideFor anti-MCM8 (ARP36694_P050) antibody is Catalog # AAP36694 (Previous Catalog # AAPP08119)
ReferenceClarke,C.A. Biochem. J. 388 (PT 2), 705-712 (2005)
Gene SymbolMCM8
Gene Full NameMinichromosome maintenance complex component 8
Alias SymbolsPOF10, C20orf154, dJ967N21.5
NCBI Gene Id84515
Protein NameDNA helicase MCM8
Description of TargetMCM8 is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are essential for the initiation of eukaryotic genome replication. The hexameric protein complex formed by the MCM proteins is a key component of the pre-replication compl
Uniprot IDQ9UJA3
Protein Accession #NP_115874
Nucleotide Accession #NM_032485
Protein Size (# AA)840
Molecular Weight94kDa
Protein InteractionsMCMBP; MCM4; MCM6; MCM7; ORC2; CDC6;
  1. What is the species homology for "MCM8 Antibody - N-terminal region (ARP36694_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "MCM8 Antibody - N-terminal region (ARP36694_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MCM8 Antibody - N-terminal region (ARP36694_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MCM8 Antibody - N-terminal region (ARP36694_P050)"?

    This target may also be called "POF10, C20orf154, dJ967N21.5" in publications.

  5. What is the shipping cost for "MCM8 Antibody - N-terminal region (ARP36694_P050)"?

    The shipping cost for this item is within the US. Please contact us for specific shipping for international orders.

  6. What is the guarantee for "MCM8 Antibody - N-terminal region (ARP36694_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MCM8 Antibody - N-terminal region (ARP36694_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "94kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MCM8 Antibody - N-terminal region (ARP36694_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MCM8"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MCM8"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MCM8"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MCM8"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MCM8"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MCM8"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.